BLASTX nr result
ID: Akebia23_contig00058911
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00058911 (209 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001273650.1| conserved hypothetical protein [Aspergillus ... 70 3e-10 >ref|XP_001273650.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] gi|119401802|gb|EAW12224.1| conserved hypothetical protein [Aspergillus clavatus NRRL 1] Length = 375 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/68 (48%), Positives = 44/68 (64%) Frame = -1 Query: 209 DWLILTGFAHNTTYFPLWVACLTFRLASEVDGERFGKLSSGYIIHRDQYENQCAFLHYPN 30 D ++LTGF+HNT+Y PL+ CL F LA + RF + SGY+ ++Y NQCAF YP Sbjct: 207 DGIVLTGFSHNTSYTPLFETCLGFELARSNNPRRFRQHDSGYLTWGNEYANQCAFYTYPF 266 Query: 29 FDVQVLLQ 6 F+ VL Q Sbjct: 267 FEPTVLQQ 274