BLASTX nr result
ID: Akebia23_contig00058707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00058707 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007046316.1| Pentatricopeptide repeat (PPR) superfamily p... 60 3e-07 ref|XP_002523226.1| pentatricopeptide repeat-containing protein,... 56 5e-06 >ref|XP_007046316.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508710251|gb|EOY02148.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 478 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = +2 Query: 2 LSNIYAASGRFNDAERVRDAMKERNVSKIPGCSLIE 109 LSNIYAA+G+F+DAE+VR+ MK++NVSK+PGCS IE Sbjct: 432 LSNIYAAAGKFDDAEKVREFMKDKNVSKVPGCSSIE 467 >ref|XP_002523226.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223537522|gb|EEF39147.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 488 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/36 (63%), Positives = 33/36 (91%) Frame = +2 Query: 2 LSNIYAASGRFNDAERVRDAMKERNVSKIPGCSLIE 109 L+N+YA GRF++AE VRD+M+E+N+SK+PGCSL+E Sbjct: 448 LANMYAGVGRFHEAEMVRDSMQEKNMSKVPGCSLLE 483