BLASTX nr result
ID: Akebia23_contig00058442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00058442 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMR68064.1| putative major facilitator superfamily protein [E... 77 2e-12 gb|EJT75935.1| hypothetical protein GGTG_05860 [Gaeumannomyces g... 75 9e-12 gb|EMD97526.1| hypothetical protein COCHEDRAFT_1125166 [Bipolari... 74 3e-11 ref|XP_007585428.1| putative major facilitator superfamily prote... 73 4e-11 emb|CCF36873.1| transmembrane transporter [Colletotrichum higgin... 72 1e-10 gb|ETS80132.1| hypothetical protein PFICI_07661 [Pestalotiopsis ... 70 2e-10 ref|XP_003709544.1| hypothetical protein MGG_06828 [Magnaporthe ... 70 2e-10 ref|XP_003841747.1| hypothetical protein LEMA_P096770.1 [Leptosp... 70 3e-10 gb|EFQ30885.1| major facilitator superfamily transporter [Collet... 69 9e-10 ref|XP_001933705.1| conserved hypothetical protein [Pyrenophora ... 68 1e-09 gb|EME87006.1| hypothetical protein MYCFIDRAFT_30231 [Pseudocerc... 65 7e-09 ref|XP_001228594.1| hypothetical protein CHGG_10667 [Chaetomium ... 65 1e-08 ref|XP_001903480.1| hypothetical protein [Podospora anserina S m... 65 1e-08 gb|EUC41749.1| hypothetical protein COCMIDRAFT_105365 [Bipolaris... 64 2e-08 gb|EOA89948.1| hypothetical protein SETTUDRAFT_147240 [Setosphae... 64 2e-08 ref|XP_007278678.1| major facilitator superfamily protein [Colle... 64 2e-08 ref|XP_006690625.1| hypothetical protein CTHT_0000710 [Chaetomiu... 64 2e-08 gb|EPE28305.1| MFS general substrate transporter [Glarea lozoyen... 64 3e-08 gb|EPB84377.1| hypothetical protein HMPREF1544_08896 [Mucor circ... 63 4e-08 ref|XP_003849038.1| hypothetical protein MYCGRDRAFT_76558 [Zymos... 63 5e-08 >gb|EMR68064.1| putative major facilitator superfamily protein [Eutypa lata UCREL1] Length = 493 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYI 128 GI YCVWEN++RA G RD+RL+GLT+E+ NDLGYRHPDFRYI Sbjct: 451 GIAYCVWENRLRARGGRDYRLEGLTEEQKNDLGYRHPDFRYI 492 >gb|EJT75935.1| hypothetical protein GGTG_05860 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 497 Score = 75.1 bits (183), Expect = 9e-12 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYIT 131 GI YC+WENK+RA GKRDHRL+GLT+EE + LG++HP FRYIT Sbjct: 455 GILYCLWENKLRAAGKRDHRLEGLTEEEQDKLGFKHPSFRYIT 497 >gb|EMD97526.1| hypothetical protein COCHEDRAFT_1125166 [Bipolaris maydis C5] Length = 505 Score = 73.6 bits (179), Expect = 3e-11 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYI 128 GI YC WEN+ R GKRDHRLQGLTD +I DLGYRHP+FRY+ Sbjct: 463 GIVYCKWENRQRDMGKRDHRLQGLTDAQIKDLGYRHPEFRYM 504 >ref|XP_007585428.1| putative major facilitator superfamily protein [Neofusicoccum parvum UCRNP2] gi|485921355|gb|EOD47095.1| putative major facilitator superfamily protein [Neofusicoccum parvum UCRNP2] Length = 492 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYI 128 GI Y VWEN+ RA GKRDHR++G +DEE+ DLGYRHP+FRYI Sbjct: 450 GIAYIVWENRQRAQGKRDHRVEGKSDEEVADLGYRHPEFRYI 491 >emb|CCF36873.1| transmembrane transporter [Colletotrichum higginsianum] Length = 132 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYIT 131 GI YC++ENK RA GKRDHRL+GLT++E LGYRHP FRY+T Sbjct: 90 GIAYCLYENKARAAGKRDHRLEGLTEDEQGRLGYRHPSFRYMT 132 >gb|ETS80132.1| hypothetical protein PFICI_07661 [Pestalotiopsis fici W106-1] Length = 491 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYI 128 GI YC WEN++RA G RD+RL+GLT++E DLGYRHP+FRYI Sbjct: 449 GIAYCKWENRLRARGGRDYRLEGLTEQEQADLGYRHPEFRYI 490 >ref|XP_003709544.1| hypothetical protein MGG_06828 [Magnaporthe oryzae 70-15] gi|351649073|gb|EHA56932.1| hypothetical protein MGG_06828 [Magnaporthe oryzae 70-15] gi|440474997|gb|ELQ43712.1| hypothetical protein OOU_Y34scaffold00140g121 [Magnaporthe oryzae Y34] gi|440480765|gb|ELQ61413.1| hypothetical protein OOW_P131scaffold01187g16 [Magnaporthe oryzae P131] Length = 496 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYIT 131 GI YC+ ENK+RA GKRDHRL+GLT++E LGYRHP FRYIT Sbjct: 454 GILYCLRENKLRAAGKRDHRLEGLTEDETLHLGYRHPSFRYIT 496 >ref|XP_003841747.1| hypothetical protein LEMA_P096770.1 [Leptosphaeria maculans JN3] gi|312218322|emb|CBX98268.1| hypothetical protein LEMA_P096770.1 [Leptosphaeria maculans JN3] Length = 785 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYIT 131 GIGYC WEN+ R GKRDHRL G ++ EI DLGYRHP++R IT Sbjct: 743 GIGYCNWENRQRDNGKRDHRLVGKSENEIRDLGYRHPEYRLIT 785 >gb|EFQ30885.1| major facilitator superfamily transporter [Colletotrichum graminicola M1.001] Length = 488 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYIT 131 GI YC++ENK RA GK+DHRL+GLT+EE + LG+RHP FRY+T Sbjct: 446 GIFYCMYENKSRATGKKDHRLEGLTNEEKDQLGHRHPSFRYMT 488 >ref|XP_001933705.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187979269|gb|EDU45895.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 508 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYI 128 GI YC WENK R GKRDHRL G T +I DLGYRHP+FRY+ Sbjct: 466 GIAYCKWENKQRDLGKRDHRLAGKTAAQIKDLGYRHPEFRYM 507 >gb|EME87006.1| hypothetical protein MYCFIDRAFT_30231 [Pseudocercospora fijiensis CIRAD86] Length = 493 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYIT 131 GI YC++EN++R+ G R +RL GL++EEI DLG++HPDFRYIT Sbjct: 451 GILYCLYENRLRSQGGRSYRLNGLSEEEIEDLGHQHPDFRYIT 493 >ref|XP_001228594.1| hypothetical protein CHGG_10667 [Chaetomium globosum CBS 148.51] gi|88176795|gb|EAQ84263.1| hypothetical protein CHGG_10667 [Chaetomium globosum CBS 148.51] Length = 501 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYIT 131 GI YC++ENK RA GKRDHRL+GLT+ E ++LG +HP+FRY T Sbjct: 459 GILYCMYENKARAAGKRDHRLEGLTEHEKDNLGRKHPNFRYWT 501 >ref|XP_001903480.1| hypothetical protein [Podospora anserina S mat+] gi|170936596|emb|CAP61255.1| unnamed protein product [Podospora anserina S mat+] Length = 441 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYIT 131 G+ YC EN++RA GKRDHRL+GLT+EE +LG RHP FRY T Sbjct: 399 GVLYCARENRVRAAGKRDHRLEGLTEEEAEELGSRHPRFRYWT 441 >gb|EUC41749.1| hypothetical protein COCMIDRAFT_105365 [Bipolaris oryzae ATCC 44560] Length = 937 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPD 116 GI YC WEN+ R GKRD+RLQG TD EI DLGYRHPD Sbjct: 463 GIIYCKWENRQRDMGKRDYRLQGKTDAEIKDLGYRHPD 500 >gb|EOA89948.1| hypothetical protein SETTUDRAFT_147240 [Setosphaeria turcica Et28A] Length = 509 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYI 128 GI YC WENK R G+RDHRL G + +I DLGYRHP+FRY+ Sbjct: 467 GIFYCKWENKQRDLGRRDHRLAGKSAAQIRDLGYRHPEFRYM 508 >ref|XP_007278678.1| major facilitator superfamily protein [Colletotrichum gloeosporioides Nara gc5] gi|429857398|gb|ELA32267.1| major facilitator superfamily protein [Colletotrichum gloeosporioides Nara gc5] Length = 507 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYI 128 GI YC++EN+MRA GKRDHRL G +++E LGYRHP FRY+ Sbjct: 465 GILYCLYENRMRAAGKRDHRLDGRSEKEQVQLGYRHPSFRYM 506 >ref|XP_006690625.1| hypothetical protein CTHT_0000710 [Chaetomium thermophilum var. thermophilum DSM 1495] gi|341038391|gb|EGS23383.1| hypothetical protein CTHT_0000710 [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 505 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYIT 131 GI YC +EN+ RA GKRDHRL+GLT+EE LG RHP +RY T Sbjct: 463 GILYCAYENRARAAGKRDHRLEGLTEEEAQKLGSRHPRYRYWT 505 >gb|EPE28305.1| MFS general substrate transporter [Glarea lozoyensis ATCC 20868] Length = 493 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYIT 131 GI Y WENK R G+RDHRL L+++E N+LGYRHP+FRYI+ Sbjct: 451 GIFYTKWENKKRERGERDHRLLNLSEQEKNELGYRHPEFRYIS 493 >gb|EPB84377.1| hypothetical protein HMPREF1544_08896 [Mucor circinelloides f. circinelloides 1006PhL] Length = 493 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +3 Query: 15 CVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYIT 131 C WENK RA GKRD+RL GLTDE++ +LG+ HP+FRY T Sbjct: 455 CRWENKKRAEGKRDYRLDGLTDEQMGELGHTHPNFRYTT 493 >ref|XP_003849038.1| hypothetical protein MYCGRDRAFT_76558 [Zymoseptoria tritici IPO323] gi|339468914|gb|EGP84014.1| hypothetical protein MYCGRDRAFT_76558 [Zymoseptoria tritici IPO323] Length = 498 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +3 Query: 3 GIGYCVWENKMRAGGKRDHRLQGLTDEEINDLGYRHPDFRYIT 131 GIGYCVWEN++R G RD RL GL +EE LG+R P FRYIT Sbjct: 456 GIGYCVWENRVRKRGGRDGRLSGLGEEERRGLGFRDPGFRYIT 498