BLASTX nr result
ID: Akebia23_contig00057420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00057420 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME45679.1| hypothetical protein DOTSEDRAFT_171250 [Dothistro... 60 3e-07 gb|EME39405.1| hypothetical protein DOTSEDRAFT_28563 [Dothistrom... 57 2e-06 ref|XP_003836245.1| predicted protein [Leptosphaeria maculans JN... 55 8e-06 >gb|EME45679.1| hypothetical protein DOTSEDRAFT_171250 [Dothistroma septosporum NZE10] Length = 760 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = -2 Query: 337 GALVCSADGKQYALCNWGKAVFQPVAEGTACKEGKIVGTGIYAVASSTT 191 GALVC+ D + LCN+G ++Q VA GTAC+ GKIVGTGIYA +T+ Sbjct: 711 GALVCNGDS-MFGLCNFGYVIYQKVALGTACRNGKIVGTGIYAGVPATS 758 >gb|EME39405.1| hypothetical protein DOTSEDRAFT_28563 [Dothistroma septosporum NZE10] Length = 127 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/49 (51%), Positives = 38/49 (77%) Frame = -2 Query: 337 GALVCSADGKQYALCNWGKAVFQPVAEGTACKEGKIVGTGIYAVASSTT 191 GA+VC+ + LCN+G V+Q V++GTAC +G++VGTGIYAV ++T+ Sbjct: 72 GAVVCNGPN-YFGLCNFGSVVWQRVSDGTACADGEVVGTGIYAVPAATS 119 >ref|XP_003836245.1| predicted protein [Leptosphaeria maculans JN3] gi|312212797|emb|CBX92880.1| predicted protein [Leptosphaeria maculans JN3] Length = 380 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -2 Query: 337 GALVCSADGKQYALCNWGKAVFQPVAEGTACKEGKI 230 GA+VCSADG Q+A+CN+G AV QPVA GT C G I Sbjct: 331 GAIVCSADGTQFAVCNFGAAVLQPVAGGTKCSNGTI 366