BLASTX nr result
ID: Akebia23_contig00056941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00056941 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001935731.1| 60S ribosomal protein L43 [Pyrenophora triti... 71 1e-10 gb|EYE96501.1| ribosomal protein L37ae [Aspergillus ruber CBS 13... 70 3e-10 ref|XP_756025.1| 60S ribosomal protein L37a [Aspergillus fumigat... 70 3e-10 ref|XP_001261157.1| 60S ribosomal protein L43 [Neosartorya fisch... 70 3e-10 ref|XP_001275968.1| 60S ribosomal protein L43 [Aspergillus clava... 70 3e-10 ref|XP_001209368.1| 60S ribosomal protein L43 [Aspergillus terre... 70 3e-10 gb|EUC27786.1| hypothetical protein COCCADRAFT_75571, partial [B... 69 5e-10 gb|EOA91067.1| hypothetical protein SETTUDRAFT_25162 [Setosphaer... 69 5e-10 gb|EMD69027.1| hypothetical protein COCSADRAFT_31800 [Bipolaris ... 69 5e-10 ref|XP_001798164.1| hypothetical protein SNOG_07837 [Phaeosphaer... 69 5e-10 gb|EPE10344.1| 60s ribosomal protein l43 [Ophiostoma piceae UAMH... 68 1e-09 ref|XP_007583014.1| putative 60s ribosomal protein l43 protein [... 68 1e-09 gb|EKG12109.1| Ribosomal protein L37ae [Macrophomina phaseolina ... 68 1e-09 ref|XP_001402255.1| 60S ribosomal protein L43 [Aspergillus niger... 68 1e-09 gb|EXJ86269.1| 60S ribosomal protein L43 [Capronia coronata CBS ... 68 2e-09 gb|EME45253.1| hypothetical protein DOTSEDRAFT_71080 [Dothistrom... 68 2e-09 gb|EKV16040.1| 60S ribosomal protein L37a [Penicillium digitatum... 68 2e-09 ref|XP_002568944.1| Pc21g19530 [Penicillium chrysogenum Wisconsi... 68 2e-09 gb|EOO02723.1| putative 60s ribosomal protein l43 protein [Togni... 67 3e-09 gb|EFW99402.1| 60S ribosomal protein l37a [Grosmannia clavigera ... 67 3e-09 >ref|XP_001935731.1| 60S ribosomal protein L43 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330906022|ref|XP_003295325.1| 60S ribosomal protein L43 [Pyrenophora teres f. teres 0-1] gi|187982830|gb|EDU48318.1| 60S ribosomal protein L37a [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311333483|gb|EFQ96582.1| hypothetical protein PTT_00414 [Pyrenophora teres f. teres 0-1] Length = 92 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +3 Query: 3 ECKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 +CKSC KVTAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 56 DCKSCGKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EYE96501.1| ribosomal protein L37ae [Aspergillus ruber CBS 135680] Length = 92 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +3 Query: 3 ECKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 ECK C K TAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 56 ECKGCNKTTAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_756025.1| 60S ribosomal protein L37a [Aspergillus fumigatus Af293] gi|66853663|gb|EAL93987.1| 60S ribosomal protein L37a [Aspergillus fumigatus Af293] gi|159130078|gb|EDP55192.1| 60S ribosomal protein L37a [Aspergillus fumigatus A1163] Length = 92 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +3 Query: 3 ECKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 ECK CKK AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 56 ECKGCKKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_001261157.1| 60S ribosomal protein L43 [Neosartorya fischeri NRRL 181] gi|119409311|gb|EAW19260.1| 60S ribosomal protein L37a [Neosartorya fischeri NRRL 181] Length = 89 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +3 Query: 3 ECKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 ECK CKK AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 53 ECKGCKKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 89 >ref|XP_001275968.1| 60S ribosomal protein L43 [Aspergillus clavatus NRRL 1] gi|119404125|gb|EAW14542.1| 60S ribosomal protein L37a [Aspergillus clavatus NRRL 1] Length = 92 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +3 Query: 3 ECKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 ECK CKK AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 56 ECKGCKKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_001209368.1| 60S ribosomal protein L43 [Aspergillus terreus NIH2624] gi|238502447|ref|XP_002382457.1| 60S ribosomal protein L43 [Aspergillus flavus NRRL3357] gi|317147898|ref|XP_003190126.1| 60S ribosomal protein L43 [Aspergillus oryzae RIB40] gi|114187815|gb|EAU29515.1| 60S ribosomal protein L43 [Aspergillus terreus NIH2624] gi|220691267|gb|EED47615.1| 60S ribosomal protein L37a [Aspergillus flavus NRRL3357] Length = 92 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +3 Query: 3 ECKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 ECK CKK AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 56 ECKGCKKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EUC27786.1| hypothetical protein COCCADRAFT_75571, partial [Bipolaris zeicola 26-R-13] gi|578484345|gb|EUN21873.1| hypothetical protein COCVIDRAFT_43672, partial [Bipolaris victoriae FI3] Length = 88 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +3 Query: 6 CKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 C+SC+K TAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 53 CRSCRKTTAGGAYTVSTPAAAATRSTIRRLREIAEV 88 >gb|EOA91067.1| hypothetical protein SETTUDRAFT_25162 [Setosphaeria turcica Et28A] Length = 92 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +3 Query: 6 CKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 C+SC+K TAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 57 CRSCRKTTAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EMD69027.1| hypothetical protein COCSADRAFT_31800 [Bipolaris sorokiniana ND90Pr] gi|452003784|gb|EMD96241.1| hypothetical protein COCHEDRAFT_1221840 [Bipolaris maydis C5] gi|477594031|gb|ENI11100.1| hypothetical protein COCC4DRAFT_46682 [Bipolaris maydis ATCC 48331] gi|576928554|gb|EUC42192.1| hypothetical protein COCMIDRAFT_8206 [Bipolaris oryzae ATCC 44560] Length = 92 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +3 Query: 6 CKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 C+SC+K TAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 57 CRSCRKTTAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_001798164.1| hypothetical protein SNOG_07837 [Phaeosphaeria nodorum SN15] gi|111064183|gb|EAT85303.1| hypothetical protein SNOG_07837 [Phaeosphaeria nodorum SN15] Length = 92 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +3 Query: 6 CKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 C+SC+K TAGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 57 CRSCRKTTAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EPE10344.1| 60s ribosomal protein l43 [Ophiostoma piceae UAMH 11346] Length = 92 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 3 ECKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 ECKSCKK AGGAYT++TPAAAATRST+RRLREIAEV Sbjct: 56 ECKSCKKTLAGGAYTLATPAAAATRSTLRRLREIAEV 92 >ref|XP_007583014.1| putative 60s ribosomal protein l43 protein [Neofusicoccum parvum UCRNP2] gi|485924791|gb|EOD49521.1| putative 60s ribosomal protein l43 protein [Neofusicoccum parvum UCRNP2] Length = 92 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +3 Query: 6 CKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 C+SCKK AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 57 CRSCKKTIAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EKG12109.1| Ribosomal protein L37ae [Macrophomina phaseolina MS6] Length = 92 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +3 Query: 6 CKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 C+SCKK AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 57 CRSCKKTIAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_001402255.1| 60S ribosomal protein L43 [Aspergillus niger CBS 513.88] gi|134074873|emb|CAK38984.1| unnamed protein product [Aspergillus niger] gi|350631906|gb|EHA20275.1| hypothetical protein ASPNIDRAFT_57444 [Aspergillus niger ATCC 1015] gi|358374403|dbj|GAA90995.1| 60S ribosomal protein L43 [Aspergillus kawachii IFO 4308] Length = 92 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +3 Query: 3 ECKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 ECK C K AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 56 ECKGCNKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EXJ86269.1| 60S ribosomal protein L43 [Capronia coronata CBS 617.96] Length = 92 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +3 Query: 6 CKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 CK CKK AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 57 CKGCKKTIAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EME45253.1| hypothetical protein DOTSEDRAFT_71080 [Dothistroma septosporum NZE10] Length = 92 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +3 Query: 3 ECKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 +CKSC K AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 56 DCKSCGKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EKV16040.1| 60S ribosomal protein L37a [Penicillium digitatum Pd1] gi|425780012|gb|EKV18035.1| 60S ribosomal protein L37a [Penicillium digitatum PHI26] Length = 92 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +3 Query: 3 ECKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 ECK C K AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 56 ECKGCDKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >ref|XP_002568944.1| Pc21g19530 [Penicillium chrysogenum Wisconsin 54-1255] gi|211590655|emb|CAP96850.1| Pc21g19530 [Penicillium chrysogenum Wisconsin 54-1255] Length = 92 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +3 Query: 3 ECKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 ECK C K AGGAYTVSTPAAAATRSTIRRLREIAEV Sbjct: 56 ECKGCDKTVAGGAYTVSTPAAAATRSTIRRLREIAEV 92 >gb|EOO02723.1| putative 60s ribosomal protein l43 protein [Togninia minima UCRPA7] Length = 84 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 3 ECKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 +C CKKVTAGGAYTVSTPAAAA RST+RRLREIAEV Sbjct: 48 KCSGCKKVTAGGAYTVSTPAAAAMRSTLRRLREIAEV 84 >gb|EFW99402.1| 60S ribosomal protein l37a [Grosmannia clavigera kw1407] Length = 92 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 3 ECKSCKKVTAGGAYTVSTPAAAATRSTIRRLREIAEV 113 +CKSCKK AGGAY VSTPAAAATRST+RRLREIAEV Sbjct: 56 QCKSCKKCIAGGAYVVSTPAAAATRSTLRRLREIAEV 92