BLASTX nr result
ID: Akebia23_contig00056911
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00056911 (474 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343360.1| PREDICTED: uncharacterized protein LOC102585... 55 8e-06 ref|XP_004234530.1| PREDICTED: uncharacterized protein LOC101244... 55 8e-06 >ref|XP_006343360.1| PREDICTED: uncharacterized protein LOC102585220 [Solanum tuberosum] Length = 401 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/51 (60%), Positives = 36/51 (70%), Gaps = 7/51 (13%) Frame = -2 Query: 134 QYGFTTYLSRSLFFPK-------QLQLLTNGFRLLKVGGYLVYSTCSLTVA 3 Q+G+TT+ R L + QLQLLTNGFRLL+VGG LVYSTCSLT A Sbjct: 291 QWGWTTFQRRVLDAERTDDLTVLQLQLLTNGFRLLRVGGALVYSTCSLTFA 341 >ref|XP_004234530.1| PREDICTED: uncharacterized protein LOC101244643 [Solanum lycopersicum] Length = 395 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/51 (60%), Positives = 36/51 (70%), Gaps = 7/51 (13%) Frame = -2 Query: 134 QYGFTTYLSRSLFFPK-------QLQLLTNGFRLLKVGGYLVYSTCSLTVA 3 Q+G+TT+ R L + QLQLLTNGFRLL+VGG LVYSTCSLT A Sbjct: 285 QWGWTTFQRRVLDAERTDDLTILQLQLLTNGFRLLRVGGALVYSTCSLTFA 335