BLASTX nr result
ID: Akebia23_contig00056888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00056888 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003856537.1| hypothetical protein MYCGRDRAFT_107483, part... 59 7e-07 >ref|XP_003856537.1| hypothetical protein MYCGRDRAFT_107483, partial [Zymoseptoria tritici IPO323] gi|339476422|gb|EGP91513.1| hypothetical protein MYCGRDRAFT_107483 [Zymoseptoria tritici IPO323] Length = 179 Score = 58.9 bits (141), Expect = 7e-07 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 11/94 (11%) Frame = -2 Query: 252 PSRASNSTQPDQSPAHLPPIHNGH-QHAS----------QTNAWTEAFERLQNQVHYNSS 106 PSR+ QP Q P H+GH +H S T+ WT A RLQ QV YN+ Sbjct: 27 PSRSV--PQPQQHPQPPHSHHHGHTRHPSLGGSNGVDRMPTDIWTSAISRLQAQVSYNTG 84 Query: 105 MLEEHQRTLSDFHEALGRMHSEMGSLWAPVDRIR 4 MLE H+R +D A+ R++ E+GS+ ++ +R Sbjct: 85 MLESHRRQFADMEMAVNRLNQELGSVAGTLNEVR 118