BLASTX nr result
ID: Akebia23_contig00056709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00056709 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007585556.1| putative ubiquitin c-terminal hydrolase prot... 63 5e-08 gb|EKG19038.1| Peptidase C19 ubiquitin carboxyl-terminal hydrola... 62 1e-07 >ref|XP_007585556.1| putative ubiquitin c-terminal hydrolase protein [Neofusicoccum parvum UCRNP2] gi|485921195|gb|EOD46985.1| putative ubiquitin c-terminal hydrolase protein [Neofusicoccum parvum UCRNP2] Length = 1144 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +3 Query: 3 YPKPEYLSDDDIITEIIANAEGVSLGFDHVNKNRSAYTKADSIFIK 140 +PK EY+ DDDI++E I+ + VSLG DHVNK+RS + K+DSIFIK Sbjct: 1099 FPKAEYIEDDDILSEKISGHDDVSLGLDHVNKSRSTWGKSDSIFIK 1144 >gb|EKG19038.1| Peptidase C19 ubiquitin carboxyl-terminal hydrolase 2 [Macrophomina phaseolina MS6] Length = 1143 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/47 (63%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +3 Query: 3 YPKPEYLSDDDIITEIIAN-AEGVSLGFDHVNKNRSAYTKADSIFIK 140 +PK EYL DDD+++E IA+ + VSLG DHVNK+RS + KADSIFIK Sbjct: 1097 FPKAEYLEDDDVLSEKIASHQDDVSLGLDHVNKSRSTWGKADSIFIK 1143