BLASTX nr result
ID: Akebia23_contig00056527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00056527 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ETN38559.1| hypothetical protein HMPREF1541_06595 [Cyphelloph... 68 1e-09 >gb|ETN38559.1| hypothetical protein HMPREF1541_06595 [Cyphellophora europaea CBS 101466] Length = 232 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/59 (52%), Positives = 45/59 (76%) Frame = +3 Query: 198 NPFTMKTIFKSGPSAAKTLASDSDTDSVNLEAENDDVVGKSRVKVFRIDCNTTIRGRDV 374 NP+TMKT++++GPSAAK L SDSD+DS E+E ++G+ R+ F+IDC T +RGR + Sbjct: 2 NPWTMKTVWRTGPSAAKALTSDSDSDSNVAESE---IIGEGRIHGFKIDCETMVRGRPI 57