BLASTX nr result
ID: Akebia23_contig00055392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00055392 (203 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511863.1| CRP, putative [Ricinus communis] gi|22354904... 110 2e-22 ref|XP_006375342.1| hypothetical protein POPTR_0014s080201g, par... 108 8e-22 ref|XP_004229878.1| PREDICTED: mediator of RNA polymerase II tra... 107 2e-21 ref|XP_006339570.1| PREDICTED: mediator of RNA polymerase II tra... 106 4e-21 ref|XP_006583297.1| PREDICTED: mediator of RNA polymerase II tra... 105 7e-21 ref|XP_002274479.2| PREDICTED: uncharacterized protein LOC100263... 105 7e-21 emb|CBI40380.3| unnamed protein product [Vitis vinifera] 105 7e-21 gb|EXC06808.1| Putative mediator of RNA polymerase II transcript... 105 9e-21 ref|XP_006576321.1| PREDICTED: mediator of RNA polymerase II tra... 104 1e-20 ref|XP_006602803.1| PREDICTED: mediator of RNA polymerase II tra... 103 3e-20 ref|XP_006602801.1| PREDICTED: mediator of RNA polymerase II tra... 103 3e-20 ref|XP_007220570.1| hypothetical protein PRUPE_ppa000036mg [Prun... 103 3e-20 ref|XP_006587853.1| PREDICTED: mediator of RNA polymerase II tra... 102 4e-20 ref|XP_006587851.1| PREDICTED: mediator of RNA polymerase II tra... 102 4e-20 ref|XP_007135071.1| hypothetical protein PHAVU_010G099000g [Phas... 102 6e-20 ref|XP_004306783.1| PREDICTED: mediator of RNA polymerase II tra... 102 6e-20 ref|XP_006445035.1| hypothetical protein CICLE_v10018441mg [Citr... 102 7e-20 ref|XP_006445033.1| hypothetical protein CICLE_v10018441mg [Citr... 102 7e-20 sp|H3K2Y6.1|MED12_ARATH RecName: Full=Mediator of RNA polymerase... 102 7e-20 gb|EYU35091.1| hypothetical protein MIMGU_mgv1a000042mg [Mimulus... 101 1e-19 >ref|XP_002511863.1| CRP, putative [Ricinus communis] gi|223549043|gb|EEF50532.1| CRP, putative [Ricinus communis] Length = 2264 Score = 110 bits (275), Expect = 2e-22 Identities = 53/67 (79%), Positives = 60/67 (89%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVLIR+NVPLLRATWFIKVTYLNQVR S S+SSG DKTQL+R+ELWTKDV+EYLQ LL Sbjct: 203 EVLIRNNVPLLRATWFIKVTYLNQVRPSSASISSGTPDKTQLSRTELWTKDVIEYLQILL 262 Query: 182 DEFISKD 202 DEF S++ Sbjct: 263 DEFFSRN 269 >ref|XP_006375342.1| hypothetical protein POPTR_0014s080201g, partial [Populus trichocarpa] gi|550323754|gb|ERP53139.1| hypothetical protein POPTR_0014s080201g, partial [Populus trichocarpa] Length = 1107 Score = 108 bits (270), Expect = 8e-22 Identities = 51/67 (76%), Positives = 61/67 (91%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVLIR+NVPLLRATWFIKVTYLNQVR STS+SSG DK Q++R+ELWTKDVV+YLQ LL Sbjct: 167 EVLIRNNVPLLRATWFIKVTYLNQVRPSSTSISSGTFDKNQVSRTELWTKDVVDYLQSLL 226 Query: 182 DEFISKD 202 DE++S++ Sbjct: 227 DEYLSRN 233 >ref|XP_004229878.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Solanum lycopersicum] Length = 2262 Score = 107 bits (267), Expect = 2e-21 Identities = 49/67 (73%), Positives = 61/67 (91%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVL+R+NVPLLRATWF+KVTYLNQVR S+S+SSG DKT ++RSE WTKDV++YLQ+LL Sbjct: 199 EVLVRNNVPLLRATWFVKVTYLNQVRPGSSSISSGVPDKTHISRSEQWTKDVIDYLQYLL 258 Query: 182 DEFISKD 202 DEFIS++ Sbjct: 259 DEFISRN 265 >ref|XP_006339570.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Solanum tuberosum] gi|565344967|ref|XP_006339571.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X2 [Solanum tuberosum] Length = 2262 Score = 106 bits (264), Expect = 4e-21 Identities = 48/67 (71%), Positives = 61/67 (91%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVL+++NVPLLRATWF+KVTYLNQVR S+S+SSG DKT ++RSE WTKDV++YLQ+LL Sbjct: 199 EVLVKNNVPLLRATWFVKVTYLNQVRPGSSSISSGVPDKTHISRSEQWTKDVIDYLQYLL 258 Query: 182 DEFISKD 202 DEFIS++ Sbjct: 259 DEFISRN 265 >ref|XP_006583297.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Glycine max] gi|571465238|ref|XP_006583298.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X2 [Glycine max] Length = 2222 Score = 105 bits (262), Expect = 7e-21 Identities = 50/67 (74%), Positives = 59/67 (88%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVLIR+NVPLLRATWFIKVTYLNQVR S +SSGA DK QL+RS++WTKDV+ YLQ L+ Sbjct: 202 EVLIRNNVPLLRATWFIKVTYLNQVRPGSVGISSGAADKIQLSRSDVWTKDVINYLQTLV 261 Query: 182 DEFISKD 202 DEF+SK+ Sbjct: 262 DEFLSKN 268 >ref|XP_002274479.2| PREDICTED: uncharacterized protein LOC100263628 [Vitis vinifera] Length = 2272 Score = 105 bits (262), Expect = 7e-21 Identities = 50/67 (74%), Positives = 60/67 (89%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVLIR+NVPLLRATWFIKVTYLNQVR S S+SSG+ DK QL+R+ELWTKDV++YLQ LL Sbjct: 202 EVLIRNNVPLLRATWFIKVTYLNQVRPASASISSGSPDKIQLSRTELWTKDVIDYLQGLL 261 Query: 182 DEFISKD 202 +EF S++ Sbjct: 262 EEFFSRN 268 >emb|CBI40380.3| unnamed protein product [Vitis vinifera] Length = 2037 Score = 105 bits (262), Expect = 7e-21 Identities = 50/67 (74%), Positives = 60/67 (89%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVLIR+NVPLLRATWFIKVTYLNQVR S S+SSG+ DK QL+R+ELWTKDV++YLQ LL Sbjct: 202 EVLIRNNVPLLRATWFIKVTYLNQVRPASASISSGSPDKIQLSRTELWTKDVIDYLQGLL 261 Query: 182 DEFISKD 202 +EF S++ Sbjct: 262 EEFFSRN 268 >gb|EXC06808.1| Putative mediator of RNA polymerase II transcription subunit 12 [Morus notabilis] Length = 2274 Score = 105 bits (261), Expect = 9e-21 Identities = 49/67 (73%), Positives = 59/67 (88%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EV+IR+NVPLLRATWFIKVTYLNQVR S ++SSG DK QL+R+ELWTKDV++YLQ LL Sbjct: 202 EVIIRNNVPLLRATWFIKVTYLNQVRPGSVNISSGTSDKAQLSRTELWTKDVIDYLQHLL 261 Query: 182 DEFISKD 202 DEF +K+ Sbjct: 262 DEFFAKN 268 >ref|XP_006576321.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Glycine max] gi|571443813|ref|XP_006576322.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X2 [Glycine max] Length = 2227 Score = 104 bits (259), Expect = 1e-20 Identities = 49/67 (73%), Positives = 59/67 (88%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVLI++NVPLLRATWFIKVTYLNQVR S +SSGA DK QL+RS++WTKDV+ YLQ L+ Sbjct: 202 EVLIKNNVPLLRATWFIKVTYLNQVRPGSVGISSGAADKIQLSRSDVWTKDVINYLQTLV 261 Query: 182 DEFISKD 202 DEF+SK+ Sbjct: 262 DEFLSKN 268 >ref|XP_006602803.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X3 [Glycine max] Length = 2246 Score = 103 bits (256), Expect = 3e-20 Identities = 51/67 (76%), Positives = 57/67 (85%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVLIR+NVPLLRATWFIKV+YLN VR S S+ SG DKTQL+ SELWTKDV+EYLQ LL Sbjct: 181 EVLIRNNVPLLRATWFIKVSYLNVVRPGSASIPSGTADKTQLSCSELWTKDVIEYLQTLL 240 Query: 182 DEFISKD 202 DEF SK+ Sbjct: 241 DEFFSKN 247 >ref|XP_006602801.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Glycine max] gi|571548449|ref|XP_006602802.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X2 [Glycine max] Length = 2266 Score = 103 bits (256), Expect = 3e-20 Identities = 51/67 (76%), Positives = 57/67 (85%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVLIR+NVPLLRATWFIKV+YLN VR S S+ SG DKTQL+ SELWTKDV+EYLQ LL Sbjct: 201 EVLIRNNVPLLRATWFIKVSYLNVVRPGSASIPSGTADKTQLSCSELWTKDVIEYLQTLL 260 Query: 182 DEFISKD 202 DEF SK+ Sbjct: 261 DEFFSKN 267 >ref|XP_007220570.1| hypothetical protein PRUPE_ppa000036mg [Prunus persica] gi|462417032|gb|EMJ21769.1| hypothetical protein PRUPE_ppa000036mg [Prunus persica] Length = 2210 Score = 103 bits (256), Expect = 3e-20 Identities = 49/67 (73%), Positives = 58/67 (86%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVL R+NVPLLRATWFIKVTYLNQVR S +SSGA DK QL+R+ELWTKDV++YLQ+LL Sbjct: 202 EVLTRNNVPLLRATWFIKVTYLNQVRPGSAIISSGAPDKAQLSRTELWTKDVIDYLQYLL 261 Query: 182 DEFISKD 202 DE S++ Sbjct: 262 DELFSRN 268 >ref|XP_006587853.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X3 [Glycine max] Length = 2198 Score = 102 bits (255), Expect = 4e-20 Identities = 51/67 (76%), Positives = 57/67 (85%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVLIR+NVPLLRATWFIKV+YLN VR S S+ SG DKTQL+ SELWTKDV+EYLQ LL Sbjct: 201 EVLIRNNVPLLRATWFIKVSYLNLVRLGSASIPSGTADKTQLSCSELWTKDVIEYLQTLL 260 Query: 182 DEFISKD 202 DEF SK+ Sbjct: 261 DEFFSKN 267 >ref|XP_006587851.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Glycine max] gi|571479407|ref|XP_006587852.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X2 [Glycine max] Length = 2259 Score = 102 bits (255), Expect = 4e-20 Identities = 51/67 (76%), Positives = 57/67 (85%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVLIR+NVPLLRATWFIKV+YLN VR S S+ SG DKTQL+ SELWTKDV+EYLQ LL Sbjct: 201 EVLIRNNVPLLRATWFIKVSYLNLVRLGSASIPSGTADKTQLSCSELWTKDVIEYLQTLL 260 Query: 182 DEFISKD 202 DEF SK+ Sbjct: 261 DEFFSKN 267 >ref|XP_007135071.1| hypothetical protein PHAVU_010G099000g [Phaseolus vulgaris] gi|561008116|gb|ESW07065.1| hypothetical protein PHAVU_010G099000g [Phaseolus vulgaris] Length = 2215 Score = 102 bits (254), Expect = 6e-20 Identities = 48/67 (71%), Positives = 58/67 (86%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 +VLIR+NVPLLRATWFIKVTYLNQV+ S +SSG DK QL+RS++WTKDV+ YLQ LL Sbjct: 202 DVLIRNNVPLLRATWFIKVTYLNQVQPGSVGISSGTADKIQLSRSDVWTKDVINYLQALL 261 Query: 182 DEFISKD 202 DEF+SK+ Sbjct: 262 DEFLSKN 268 >ref|XP_004306783.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like [Fragaria vesca subsp. vesca] Length = 2261 Score = 102 bits (254), Expect = 6e-20 Identities = 49/67 (73%), Positives = 60/67 (89%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVL R+NVPLLRATWF+KVTYLNQ+R S+S+S G DKTQL+R+ELWTKDV+EYLQ+LL Sbjct: 202 EVLTRNNVPLLRATWFVKVTYLNQIRPGSSSIS-GIPDKTQLSRTELWTKDVIEYLQYLL 260 Query: 182 DEFISKD 202 DEF S++ Sbjct: 261 DEFFSRN 267 >ref|XP_006445035.1| hypothetical protein CICLE_v10018441mg [Citrus clementina] gi|567905096|ref|XP_006445036.1| hypothetical protein CICLE_v10018441mg [Citrus clementina] gi|567905098|ref|XP_006445037.1| hypothetical protein CICLE_v10018441mg [Citrus clementina] gi|568876055|ref|XP_006491101.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X1 [Citrus sinensis] gi|568876057|ref|XP_006491102.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X2 [Citrus sinensis] gi|557547297|gb|ESR58275.1| hypothetical protein CICLE_v10018441mg [Citrus clementina] gi|557547298|gb|ESR58276.1| hypothetical protein CICLE_v10018441mg [Citrus clementina] gi|557547299|gb|ESR58277.1| hypothetical protein CICLE_v10018441mg [Citrus clementina] Length = 2277 Score = 102 bits (253), Expect = 7e-20 Identities = 49/67 (73%), Positives = 58/67 (86%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVLIR+NVPLLRATWFIKVTYLNQVR S + SGA DK QL+R+E+WTKDV++YLQ LL Sbjct: 202 EVLIRNNVPLLRATWFIKVTYLNQVRHGSANSLSGAQDKIQLSRTEIWTKDVIDYLQHLL 261 Query: 182 DEFISKD 202 DEF S++ Sbjct: 262 DEFFSRN 268 >ref|XP_006445033.1| hypothetical protein CICLE_v10018441mg [Citrus clementina] gi|567905092|ref|XP_006445034.1| hypothetical protein CICLE_v10018441mg [Citrus clementina] gi|567905100|ref|XP_006445038.1| hypothetical protein CICLE_v10018441mg [Citrus clementina] gi|568876059|ref|XP_006491103.1| PREDICTED: mediator of RNA polymerase II transcription subunit 12-like isoform X3 [Citrus sinensis] gi|557547295|gb|ESR58273.1| hypothetical protein CICLE_v10018441mg [Citrus clementina] gi|557547296|gb|ESR58274.1| hypothetical protein CICLE_v10018441mg [Citrus clementina] gi|557547300|gb|ESR58278.1| hypothetical protein CICLE_v10018441mg [Citrus clementina] Length = 2239 Score = 102 bits (253), Expect = 7e-20 Identities = 49/67 (73%), Positives = 58/67 (86%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVLIR+NVPLLRATWFIKVTYLNQVR S + SGA DK QL+R+E+WTKDV++YLQ LL Sbjct: 164 EVLIRNNVPLLRATWFIKVTYLNQVRHGSANSLSGAQDKIQLSRTEIWTKDVIDYLQHLL 223 Query: 182 DEFISKD 202 DEF S++ Sbjct: 224 DEFFSRN 230 >sp|H3K2Y6.1|MED12_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 12; AltName: Full=Protein CENTER CITY; AltName: Full=Protein CRYPTIC PRECOCIOUS gi|374428817|dbj|BAL49816.1| cryptic precocious [Arabidopsis thaliana] gi|374428819|dbj|BAL49817.1| cryptic precocious splicing variant [Arabidopsis thaliana] gi|374428821|dbj|BAL49818.1| cryptic precocious [Arabidopsis thaliana] Length = 2235 Score = 102 bits (253), Expect = 7e-20 Identities = 48/67 (71%), Positives = 57/67 (85%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVLIR+NVPLLRATWFIKVTYLNQVR ++SSG DKTQ +R E WTKDV+EYLQ+LL Sbjct: 199 EVLIRNNVPLLRATWFIKVTYLNQVRPSPAAISSGTPDKTQASRCEQWTKDVIEYLQYLL 258 Query: 182 DEFISKD 202 DE +S++ Sbjct: 259 DELLSRN 265 >gb|EYU35091.1| hypothetical protein MIMGU_mgv1a000042mg [Mimulus guttatus] Length = 2152 Score = 101 bits (251), Expect = 1e-19 Identities = 48/67 (71%), Positives = 59/67 (88%) Frame = +2 Query: 2 EVLIRHNVPLLRATWFIKVTYLNQVRSVSTSVSSGALDKTQLARSELWTKDVVEYLQFLL 181 EVLIR+NVPLLRATWFIKVTYLNQVR+ S++ SS KTQ +RSE WTKDV+EYLQ+LL Sbjct: 201 EVLIRNNVPLLRATWFIKVTYLNQVRAASSNSSSSFNGKTQFSRSEQWTKDVIEYLQYLL 260 Query: 182 DEFISKD 202 DEF++++ Sbjct: 261 DEFMARN 267