BLASTX nr result
ID: Akebia23_contig00055172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00055172 (470 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC35532.1| contains similarity to proteases [Arabidopsis tha... 61 2e-07 emb|CAB40035.1| retrotransposon like protein [Arabidopsis thalia... 61 2e-07 ref|XP_006367809.1| PREDICTED: uncharacterized protein LOC102582... 56 5e-06 gb|AAD21687.1| Strong similarity to gi|3600044 T12H20.12 proteas... 56 5e-06 >gb|AAC35532.1| contains similarity to proteases [Arabidopsis thaliana] Length = 1392 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%) Frame = -1 Query: 209 YALDGEPY-TLFSNRFRKINEEGWHPHLGHPQQKIVYHLGYKKFIFFDSENKNDCICESC 33 Y L P+ T +S R + ++E WH LGHP ++++ HL K I + + N +CE+C Sbjct: 438 YVLKDVPFQTYYSTRQQSSDDEVWHQRLGHPNKEVLQHLIKTKAIVVNKTSSN--MCEAC 495 Query: 32 QLGKSCRLPF 3 Q+GK CRLPF Sbjct: 496 QMGKVCRLPF 505 >emb|CAB40035.1| retrotransposon like protein [Arabidopsis thaliana] gi|7267767|emb|CAB81170.1| retrotransposon like protein [Arabidopsis thaliana] Length = 1515 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%) Frame = -1 Query: 209 YALDGEPY-TLFSNRFRKINEEGWHPHLGHPQQKIVYHLGYKKFIFFDSENKNDCICESC 33 Y L P+ T +S R + ++E WH LGHP ++++ HL K I + + N +CE+C Sbjct: 435 YVLKDVPFQTYYSTRQQSSDDEVWHQRLGHPNKEVLQHLIKTKAIVVNKTSSN--MCEAC 492 Query: 32 QLGKSCRLPF 3 Q+GK CRLPF Sbjct: 493 QMGKVCRLPF 502 >ref|XP_006367809.1| PREDICTED: uncharacterized protein LOC102582397, partial [Solanum tuberosum] Length = 794 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/47 (53%), Positives = 28/47 (59%) Frame = -1 Query: 143 WHPHLGHPQQKIVYHLGYKKFIFFDSENKNDCICESCQLGKSCRLPF 3 WH LGHP K + L FI S NK +C SCQLGKSC+LPF Sbjct: 716 WHTKLGHPSLKYLKVLSSNSFINISSWNKMPTVCSSCQLGKSCKLPF 762 >gb|AAD21687.1| Strong similarity to gi|3600044 T12H20.12 protease homolog from Arabidopsis thaliana BAC gb|AF080119 and is a member of the reverse transcriptase family PF|00078 [Arabidopsis thaliana] Length = 1415 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 1/70 (1%) Frame = -1 Query: 209 YALDGEPYT-LFSNRFRKINEEGWHPHLGHPQQKIVYHLGYKKFIFFDSENKNDCICESC 33 Y L+ + + L+SNR EE WH LGH K + HL K I ++++ +CE C Sbjct: 433 YVLENQEFVALYSNRQCAATEEVWHHRLGHANSKALQHLQNSKAIQI-NKSRTSPVCEPC 491 Query: 32 QLGKSCRLPF 3 Q+GKS RLPF Sbjct: 492 QMGKSSRLPF 501