BLASTX nr result
ID: Akebia23_contig00055091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00055091 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007211362.1| hypothetical protein PRUPE_ppa002367mg [Prun... 73 5e-11 ref|XP_002283097.2| PREDICTED: TPR repeat-containing thioredoxin... 72 1e-10 emb|CBI20201.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_004171005.1| PREDICTED: LOW QUALITY PROTEIN: TPR repeat-c... 70 4e-10 ref|XP_004146029.1| PREDICTED: TPR repeat-containing thioredoxin... 70 4e-10 gb|EXC18487.1| TPR repeat-containing thioredoxin TTL1 [Morus not... 67 3e-09 ref|XP_004294076.1| PREDICTED: TPR repeat-containing thioredoxin... 66 6e-09 emb|CAN62839.1| hypothetical protein VITISV_003392 [Vitis vinifera] 63 4e-08 ref|XP_002524280.1| Small glutamine-rich tetratricopeptide repea... 61 2e-07 ref|XP_007021716.1| Tetratricopetide-repeat thioredoxin-like 1 i... 60 4e-07 ref|XP_007021715.1| Tetratricopetide-repeat thioredoxin-like 1 i... 60 4e-07 ref|XP_007021714.1| Tetratricopetide-repeat thioredoxin-like 1 i... 60 4e-07 ref|XP_007021713.1| Tetratricopetide-repeat thioredoxin-like 1 i... 60 4e-07 emb|CBI21978.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_003541820.1| PREDICTED: TPR repeat-containing thioredoxin... 59 7e-07 ref|XP_002276519.1| PREDICTED: TPR repeat-containing thioredoxin... 58 2e-06 ref|XP_006592931.1| PREDICTED: TPR repeat-containing thioredoxin... 57 3e-06 ref|XP_004244266.1| PREDICTED: TPR repeat-containing thioredoxin... 56 4e-06 gb|EPS72637.1| hypothetical protein M569_02119, partial [Genlise... 55 8e-06 ref|XP_006493603.1| PREDICTED: TPR repeat-containing thioredoxin... 55 1e-05 >ref|XP_007211362.1| hypothetical protein PRUPE_ppa002367mg [Prunus persica] gi|462407227|gb|EMJ12561.1| hypothetical protein PRUPE_ppa002367mg [Prunus persica] Length = 680 Score = 72.8 bits (177), Expect = 5e-11 Identities = 40/85 (47%), Positives = 47/85 (55%) Frame = -3 Query: 257 HSRKPITEIGFDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRTNRGGRDGANAXXXXX 78 H KPI+E+G DSL D+F +L CE NKPDF+E DLGSPVSPLRT + G Sbjct: 3 HPGKPISELGLDSLNDRFRDSLSCEANKPDFRELDLGSPVSPLRTRQSG------GLATA 56 Query: 77 XXXXXXXXXXXXGKNGNNPIVKISD 3 G+NG NP K SD Sbjct: 57 TSSSSSSSGSFSGRNGPNPAAKRSD 81 >ref|XP_002283097.2| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Vitis vinifera] Length = 656 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/85 (42%), Positives = 48/85 (56%) Frame = -3 Query: 257 HSRKPITEIGFDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRTNRGGRDGANAXXXXX 78 HS KP++E+G ++ D+F L C++NKPDFKE DLGSPVSPLRT R G G+ Sbjct: 3 HSGKPMSEVGLGAVADRFRETLNCDNNKPDFKELDLGSPVSPLRTRRSGPAGSGV---TT 59 Query: 77 XXXXXXXXXXXXGKNGNNPIVKISD 3 +N NN + K +D Sbjct: 60 TSSSSSSSGSVSCRNANNQLAKRAD 84 >emb|CBI20201.3| unnamed protein product [Vitis vinifera] Length = 645 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/53 (58%), Positives = 40/53 (75%) Frame = -3 Query: 257 HSRKPITEIGFDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRTNRGGRDGA 99 HS KP++E+G ++ D+F L C++NKPDFKE DLGSPVSPLRT R G G+ Sbjct: 3 HSGKPMSEVGLGAVADRFRETLNCDNNKPDFKELDLGSPVSPLRTRRSGPAGS 55 >ref|XP_004171005.1| PREDICTED: LOW QUALITY PROTEIN: TPR repeat-containing thioredoxin TTL1-like [Cucumis sativus] Length = 698 Score = 69.7 bits (169), Expect = 4e-10 Identities = 39/87 (44%), Positives = 51/87 (58%), Gaps = 2/87 (2%) Frame = -3 Query: 257 HSRKPITEIGFDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRTNR--GGRDGANAXXX 84 HS PI+++ FD L+D+F ++ CE NKPDF+E DLGSPVSPLRT GG A++ Sbjct: 3 HSGNPISDLRFDHLSDRFRDSVSCEVNKPDFRELDLGSPVSPLRTRHQTGGGPAASS--- 59 Query: 83 XXXXXXXXXXXXXXGKNGNNPIVKISD 3 G+NG NP+ K SD Sbjct: 60 -----SSSSSGSVSGRNGPNPVAKRSD 81 >ref|XP_004146029.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Cucumis sativus] Length = 698 Score = 69.7 bits (169), Expect = 4e-10 Identities = 39/87 (44%), Positives = 51/87 (58%), Gaps = 2/87 (2%) Frame = -3 Query: 257 HSRKPITEIGFDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRTNR--GGRDGANAXXX 84 HS PI+++ FD L+D+F ++ CE NKPDF+E DLGSPVSPLRT GG A++ Sbjct: 3 HSGNPISDLRFDHLSDRFRDSVSCEVNKPDFRELDLGSPVSPLRTRHQTGGGPAASS--- 59 Query: 83 XXXXXXXXXXXXXXGKNGNNPIVKISD 3 G+NG NP+ K SD Sbjct: 60 -----SSSSSGSVSGRNGPNPVAKRSD 81 >gb|EXC18487.1| TPR repeat-containing thioredoxin TTL1 [Morus notabilis] Length = 689 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -3 Query: 257 HSRKPITEIGFDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRT 123 HS KP++E+G DSL D+ +L CE NKPDF+E DLGSPVSPLRT Sbjct: 3 HSGKPVSELGLDSLGDRLAESLSCEANKPDFRELDLGSPVSPLRT 47 >ref|XP_004294076.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Fragaria vesca subsp. vesca] Length = 658 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/51 (62%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -3 Query: 257 HSRKPITEIG--FDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRTNRGG 111 HS KPI+E G DSL+D+ +L CE NKPDF+E DLGSPVSPLRT++ G Sbjct: 3 HSGKPISETGGGVDSLSDRLRESLSCEANKPDFRELDLGSPVSPLRTHQSG 53 >emb|CAN62839.1| hypothetical protein VITISV_003392 [Vitis vinifera] Length = 815 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/55 (52%), Positives = 36/55 (65%) Frame = -3 Query: 257 HSRKPITEIGFDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRTNRGGRDGANA 93 ++ K I E+G DSL+D+ L CE NKPDF+E DLGSPVSPL T G G + Sbjct: 3 YTSKSIQEMGIDSLSDRVRDTLSCESNKPDFRELDLGSPVSPLMTRGSGGGGGGS 57 >ref|XP_002524280.1| Small glutamine-rich tetratricopeptide repeat-containing protein A, putative [Ricinus communis] gi|223536471|gb|EEF38119.1| Small glutamine-rich tetratricopeptide repeat-containing protein A, putative [Ricinus communis] Length = 640 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/83 (40%), Positives = 42/83 (50%), Gaps = 1/83 (1%) Frame = -3 Query: 257 HSRKPITEIGFDSLTDQF-NGALICEDNKPDFKEFDLGSPVSPLRTNRGGRDGANAXXXX 81 HS PI E+G DSLTDQ + + E NKPDF+E DLGSPVSPLRT Sbjct: 3 HSGNPIGEVGLDSLTDQLRDSSCSLEANKPDFRELDLGSPVSPLRTRGLNTTTTTTTTTT 62 Query: 80 XXXXXXXXXXXXXGKNGNNPIVK 12 +NG +P++K Sbjct: 63 TSSSSSSSGSASGTRNGPHPVLK 85 >ref|XP_007021716.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 4, partial [Theobroma cacao] gi|508721344|gb|EOY13241.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 4, partial [Theobroma cacao] Length = 628 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = -3 Query: 257 HSRKPITEIG-FDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRTNRGG 111 H KP+TE+G D L DQ +L + NKPDF+E DLGSPVSPLRT + G Sbjct: 3 HLGKPVTELGRLDKLADQLRDSLSYDVNKPDFRELDLGSPVSPLRTRQPG 52 >ref|XP_007021715.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 3 [Theobroma cacao] gi|508721343|gb|EOY13240.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 3 [Theobroma cacao] Length = 656 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = -3 Query: 257 HSRKPITEIG-FDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRTNRGG 111 H KP+TE+G D L DQ +L + NKPDF+E DLGSPVSPLRT + G Sbjct: 3 HLGKPVTELGRLDKLADQLRDSLSYDVNKPDFRELDLGSPVSPLRTRQPG 52 >ref|XP_007021714.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 2 [Theobroma cacao] gi|508721342|gb|EOY13239.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 2 [Theobroma cacao] Length = 696 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = -3 Query: 257 HSRKPITEIG-FDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRTNRGG 111 H KP+TE+G D L DQ +L + NKPDF+E DLGSPVSPLRT + G Sbjct: 3 HLGKPVTELGRLDKLADQLRDSLSYDVNKPDFRELDLGSPVSPLRTRQPG 52 >ref|XP_007021713.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 1 [Theobroma cacao] gi|508721341|gb|EOY13238.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 1 [Theobroma cacao] Length = 698 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = -3 Query: 257 HSRKPITEIG-FDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRTNRGG 111 H KP+TE+G D L DQ +L + NKPDF+E DLGSPVSPLRT + G Sbjct: 3 HLGKPVTELGRLDKLADQLRDSLSYDVNKPDFRELDLGSPVSPLRTRQPG 52 >emb|CBI21978.3| unnamed protein product [Vitis vinifera] Length = 675 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = -3 Query: 257 HSRKPITEIGFDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRTNRGGRDG 102 ++ K I E+G DSL+D+ L CE NKPDF+E DLGSPVSP + G+ G Sbjct: 3 YTSKSIQEMGIDSLSDRVRDTLSCESNKPDFRELDLGSPVSPSSGSVSGKTG 54 >ref|XP_003541820.1| PREDICTED: TPR repeat-containing thioredoxin TTL1 [Glycine max] Length = 692 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/53 (58%), Positives = 39/53 (73%), Gaps = 6/53 (11%) Frame = -3 Query: 254 SRKPITEI-GFDS-LTDQFNGALICEDN----KPDFKEFDLGSPVSPLRTNRG 114 S KP++E+ G D+ +D+F AL C+DN KPDF+E DLGSPVSPLRT RG Sbjct: 5 SGKPVSEVVGIDATFSDRFRDALTCDDNNNINKPDFRELDLGSPVSPLRTTRG 57 >ref|XP_002276519.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Vitis vinifera] Length = 710 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/47 (55%), Positives = 31/47 (65%) Frame = -3 Query: 233 IGFDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRTNRGGRDGANA 93 +G DSL+D+ L CE NKPDF+E DLGSPVSPL T G G + Sbjct: 1 MGIDSLSDRVRDTLSCESNKPDFRELDLGSPVSPLMTRGSGGGGGGS 47 >ref|XP_006592931.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 698 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/57 (54%), Positives = 38/57 (66%), Gaps = 10/57 (17%) Frame = -3 Query: 254 SRKPITEI-GFDS-LTDQFNGALICED--------NKPDFKEFDLGSPVSPLRTNRG 114 S KP++E+ G D+ D+F AL C+D NKPDF+E DLGSPVSPLRT RG Sbjct: 5 SGKPVSEVVGIDATFADRFRDALTCDDGSNNNNNINKPDFRELDLGSPVSPLRTTRG 61 >ref|XP_004244266.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Solanum lycopersicum] Length = 701 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/55 (50%), Positives = 35/55 (63%), Gaps = 7/55 (12%) Frame = -3 Query: 254 SRKPITEIGFDSLTDQFNGALIC-------EDNKPDFKEFDLGSPVSPLRTNRGG 111 S +P++EIG D +TD+ +L C E NKPDF+E DLGSPVSPLR G Sbjct: 4 SGRPMSEIGLDGVTDRLKNSLTCAEDGNGVEINKPDFRELDLGSPVSPLRNRPRG 58 >gb|EPS72637.1| hypothetical protein M569_02119, partial [Genlisea aurea] Length = 684 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 2/57 (3%) Frame = -3 Query: 257 HSRKPITEIGFDSLTDQFNGALIC--EDNKPDFKEFDLGSPVSPLRTNRGGRDGANA 93 HS K E+G +SL+ +F +L C ++NKPDF+E DLGSP+SPLR GR A A Sbjct: 2 HSGKSKPELGLESLSGRFRASLACGEDENKPDFRELDLGSPISPLR----GRTAAAA 54 >ref|XP_006493603.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Citrus sinensis] Length = 712 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -3 Query: 242 ITEIGFDSLTDQFNGALICEDNKPDFKEFDLGSPVSPLRTNRGG 111 ITE+GF +L+ + AL CE NKPDF+E DLGSPVSPLRT G Sbjct: 17 ITELGFHNLSF-CDDALSCEANKPDFRELDLGSPVSPLRTRPSG 59