BLASTX nr result
ID: Akebia23_contig00055077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00055077 (297 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOA87395.1| hypothetical protein SETTUDRAFT_89281 [Setosphaer... 64 2e-08 ref|XP_003839970.1| hypothetical protein LEMA_P107560.1 [Leptosp... 62 8e-08 ref|XP_001800577.1| hypothetical protein SNOG_10298 [Phaeosphaer... 62 8e-08 gb|EUC47287.1| hypothetical protein COCMIDRAFT_3705 [Bipolaris o... 61 1e-07 gb|EUC29601.1| hypothetical protein COCCADRAFT_8215 [Bipolaris z... 61 1e-07 gb|EMD87992.1| hypothetical protein COCHEDRAFT_1206246 [Bipolari... 61 1e-07 gb|EMD64975.1| hypothetical protein COCSADRAFT_316628 [Bipolaris... 61 1e-07 ref|XP_001936268.1| conserved hypothetical protein [Pyrenophora ... 59 9e-07 ref|XP_003306213.1| hypothetical protein PTT_19310 [Pyrenophora ... 57 3e-06 >gb|EOA87395.1| hypothetical protein SETTUDRAFT_89281 [Setosphaeria turcica Et28A] Length = 259 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = -3 Query: 163 MTQVIAKYAAKKMLSSEMNKYKSKSVDSPYDPFYEMVPHPR 41 M ++AKYA KK L EM KYKSKS PYDPFYE +PHPR Sbjct: 1 MANLVAKYAMKKALGKEMEKYKSKSASGPYDPFYEEIPHPR 41 >ref|XP_003839970.1| hypothetical protein LEMA_P107560.1 [Leptosphaeria maculans JN3] gi|312216541|emb|CBX96491.1| hypothetical protein LEMA_P107560.1 [Leptosphaeria maculans JN3] Length = 262 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -3 Query: 163 MTQVIAKYAAKKMLSSEMNKYKSKSVDSPYDPFYEMVPHP 44 MT +IAKYA KK+L EM KYKSK PYDP+YE++PHP Sbjct: 1 MTGLIAKYAMKKVLGKEMEKYKSKDAAGPYDPYYEVIPHP 40 >ref|XP_001800577.1| hypothetical protein SNOG_10298 [Phaeosphaeria nodorum SN15] gi|111061513|gb|EAT82633.1| hypothetical protein SNOG_10298 [Phaeosphaeria nodorum SN15] Length = 253 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -3 Query: 163 MTQVIAKYAAKKMLSSEMNKYKSKSVDSPYDPFYEMVPHP 44 MTQ++AKYA KK++ EM KY+SK V PYDP+Y+ +PHP Sbjct: 1 MTQLVAKYAMKKVMGKEMEKYRSKGVGGPYDPYYDEIPHP 40 >gb|EUC47287.1| hypothetical protein COCMIDRAFT_3705 [Bipolaris oryzae ATCC 44560] Length = 264 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = -3 Query: 163 MTQVIAKYAAKKMLSSEMNKYKSKSVDSPYDPFYEMVPHPR 41 M ++AKYA KK L EM KY+ KS PYDPFYE +PHPR Sbjct: 1 MANLVAKYAMKKALGKEMEKYRGKSASGPYDPFYEEIPHPR 41 >gb|EUC29601.1| hypothetical protein COCCADRAFT_8215 [Bipolaris zeicola 26-R-13] gi|578486939|gb|EUN24404.1| hypothetical protein COCVIDRAFT_18168 [Bipolaris victoriae FI3] Length = 264 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = -3 Query: 163 MTQVIAKYAAKKMLSSEMNKYKSKSVDSPYDPFYEMVPHPR 41 M ++AKYA KK L EM KY+ KS PYDPFYE +PHPR Sbjct: 1 MANLVAKYAMKKALGKEMEKYRGKSASGPYDPFYEEIPHPR 41 >gb|EMD87992.1| hypothetical protein COCHEDRAFT_1206246 [Bipolaris maydis C5] gi|477586423|gb|ENI03508.1| hypothetical protein COCC4DRAFT_200361 [Bipolaris maydis ATCC 48331] Length = 264 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = -3 Query: 163 MTQVIAKYAAKKMLSSEMNKYKSKSVDSPYDPFYEMVPHPR 41 M ++AKYA KK L EM KY+ KS PYDPFYE +PHPR Sbjct: 1 MANLVAKYAMKKALGKEMEKYRGKSASGPYDPFYEEIPHPR 41 >gb|EMD64975.1| hypothetical protein COCSADRAFT_316628 [Bipolaris sorokiniana ND90Pr] Length = 264 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = -3 Query: 163 MTQVIAKYAAKKMLSSEMNKYKSKSVDSPYDPFYEMVPHPR 41 M ++AKYA KK L EM KY+ KS PYDPFYE +PHPR Sbjct: 1 MANLVAKYAMKKALGKEMEKYRGKSASGPYDPFYEEIPHPR 41 >ref|XP_001936268.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983367|gb|EDU48855.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 257 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/40 (62%), Positives = 28/40 (70%) Frame = -3 Query: 163 MTQVIAKYAAKKMLSSEMNKYKSKSVDSPYDPFYEMVPHP 44 M ++AKYA KK L EM KYK KSV PYDPFY +PHP Sbjct: 1 MANLVAKYAMKKALGKEMEKYKGKSVAGPYDPFYVEIPHP 40 >ref|XP_003306213.1| hypothetical protein PTT_19310 [Pyrenophora teres f. teres 0-1] gi|311316354|gb|EFQ85685.1| hypothetical protein PTT_19310 [Pyrenophora teres f. teres 0-1] Length = 257 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -3 Query: 163 MTQVIAKYAAKKMLSSEMNKYKSKSVDSPYDPFYEMVPHP 44 M ++AKYA KK L EM KYK KS PYDPFY +PHP Sbjct: 1 MANLVAKYAMKKALGKEMEKYKGKSAAGPYDPFYVEIPHP 40