BLASTX nr result
ID: Akebia23_contig00054984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00054984 (420 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EQB47836.1| hypothetical protein CGLO_12990 [Colletotrichum g... 90 4e-16 gb|EPS27305.1| hypothetical protein PDE_02248 [Penicillium oxali... 90 4e-16 gb|ENI02547.1| hypothetical protein COCC4DRAFT_145443, partial [... 90 4e-16 gb|ENH81096.1| 60s ribosomal protein l39 [Colletotrichum orbicul... 90 4e-16 gb|EGD93107.1| hypothetical protein TESG_00663 [Trichophyton ton... 90 4e-16 ref|XP_002848813.1| hypothetical protein MCYG_01747 [Arthroderma... 90 4e-16 ref|XP_002544670.1| predicted protein [Uncinocarpus reesii 1704]... 90 4e-16 ref|XP_002482271.1| ribosomal protein L39e, putative [Talaromyce... 90 4e-16 ref|XP_001542836.1| 60S ribosomal protein L39 [Ajellomyces capsu... 90 4e-16 ref|XP_001242303.1| 60S ribosomal protein L39 [Coccidioides immi... 90 4e-16 gb|EHK48913.1| hypothetical protein TRIATDRAFT_254996 [Trichoder... 89 5e-16 ref|XP_006961218.1| ribosomal protein L39e [Trichoderma reesei Q... 89 5e-16 ref|XP_001229558.1| 60S ribosomal protein L39 [Chaetomium globos... 89 6e-16 gb|ETN40271.1| 60S ribosomal protein L39 [Cyphellophora europaea... 89 6e-16 gb|EMF12058.1| ribosomal protein L39e [Sphaerulina musiva SO2202] 89 6e-16 gb|EME82094.1| hypothetical protein MYCFIDRAFT_30141, partial [P... 89 6e-16 ref|XP_003850033.1| 60S ribosomal protein L39 [Zymoseptoria trit... 89 6e-16 ref|XP_001908102.1| hypothetical protein [Podospora anserina S m... 89 6e-16 ref|XP_959018.2| 60S ribosomal protein L39 [Neurospora crassa OR... 89 6e-16 ref|XP_387097.1| hypothetical protein FG06921.1 [Fusarium gramin... 89 8e-16 >gb|EQB47836.1| hypothetical protein CGLO_12990 [Colletotrichum gloeosporioides Cg-14] Length = 97 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 57 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 97 >gb|EPS27305.1| hypothetical protein PDE_02248 [Penicillium oxalicum 114-2] Length = 51 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 11 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|ENI02547.1| hypothetical protein COCC4DRAFT_145443, partial [Bipolaris maydis ATCC 48331] Length = 51 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 11 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|ENH81096.1| 60s ribosomal protein l39 [Colletotrichum orbiculare MAFF 240422] Length = 77 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 37 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 77 >gb|EGD93107.1| hypothetical protein TESG_00663 [Trichophyton tonsurans CBS 112818] Length = 118 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 78 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 118 >ref|XP_002848813.1| hypothetical protein MCYG_01747 [Arthroderma otae CBS 113480] gi|238839266|gb|EEQ28928.1| hypothetical protein MCYG_01747 [Arthroderma otae CBS 113480] Length = 94 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 54 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 94 >ref|XP_002544670.1| predicted protein [Uncinocarpus reesii 1704] gi|237904940|gb|EEP79341.1| predicted protein [Uncinocarpus reesii 1704] Length = 183 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 143 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 183 >ref|XP_002482271.1| ribosomal protein L39e, putative [Talaromyces stipitatus ATCC 10500] gi|218718859|gb|EED18279.1| ribosomal protein L39e, putative [Talaromyces stipitatus ATCC 10500] Length = 109 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 69 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 109 >ref|XP_001542836.1| 60S ribosomal protein L39 [Ajellomyces capsulatus NAm1] gi|327292414|ref|XP_003230906.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 118892] gi|389629646|ref|XP_003712476.1| 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] gi|615467304|ref|XP_007599880.1| hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] gi|150411016|gb|EDN06404.1| ribosomal protein L39 [Ajellomyces capsulatus NAm1] gi|259487695|tpe|CBF86564.1| TPA: conserved hypothetical protein [Aspergillus nidulans FGSC A4] gi|326466942|gb|EGD92395.1| ribosomal L39 protein [Trichophyton rubrum CBS 118892] gi|351644808|gb|EHA52669.1| 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] gi|402083766|gb|EJT78784.1| 60S ribosomal protein L39 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|440475962|gb|ELQ44608.1| hypothetical protein OOU_Y34scaffold00071g24 [Magnaporthe oryzae Y34] gi|440487781|gb|ELQ67556.1| hypothetical protein OOW_P131scaffold00314g129 [Magnaporthe oryzae P131] gi|482812667|gb|EOA89386.1| hypothetical protein SETTUDRAFT_46231 [Setosphaeria turcica Et28A] gi|550808028|gb|ERS99941.1| 60S ribosomal protein L39 [Sporothrix schenckii ATCC 58251] gi|588894534|gb|EXF76478.1| hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] gi|607883430|gb|EZF28033.1| 60S ribosomal protein L39 [Trichophyton rubrum MR850] gi|607910227|gb|EZF47097.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 100081] gi|607922284|gb|EZF57748.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 288.86] gi|607934286|gb|EZF68319.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 289.86] gi|607946260|gb|EZF79023.1| 60S ribosomal protein L39 [Trichophyton soudanense CBS 452.61] gi|607958340|gb|EZF89637.1| 60S ribosomal protein L39 [Trichophyton rubrum MR1448] gi|607970581|gb|EZG00476.1| 60S ribosomal protein L39 [Trichophyton rubrum MR1459] gi|607976489|gb|EZG05683.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 735.88] gi|607994655|gb|EZG22078.1| 60S ribosomal protein L39 [Trichophyton rubrum CBS 202.88] Length = 51 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 11 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >ref|XP_001242303.1| 60S ribosomal protein L39 [Coccidioides immitis RS] gi|303319107|ref|XP_003069553.1| 60S ribosomal protein L39 [Coccidioides posadasii C735 delta SOWgp] gi|240109239|gb|EER27408.1| 60S ribosomal protein L39, putative [Coccidioides posadasii C735 delta SOWgp] gi|320041052|gb|EFW22985.1| hypothetical protein CPSG_00884 [Coccidioides posadasii str. Silveira] gi|392865200|gb|EAS30975.2| 60S ribosomal protein L39 [Coccidioides immitis RS] gi|451854430|gb|EMD67723.1| hypothetical protein COCSADRAFT_111781 [Bipolaris sorokiniana ND90Pr] gi|451999507|gb|EMD91969.1| hypothetical protein COCHEDRAFT_1223922 [Bipolaris maydis C5] gi|576923975|gb|EUC38088.1| hypothetical protein COCCADRAFT_1122 [Bipolaris zeicola 26-R-13] gi|576933721|gb|EUC47244.1| hypothetical protein COCMIDRAFT_3805 [Bipolaris oryzae ATCC 44560] gi|578492993|gb|EUN30389.1| hypothetical protein COCVIDRAFT_23909 [Bipolaris victoriae FI3] Length = 51 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 11 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >gb|EHK48913.1| hypothetical protein TRIATDRAFT_254996 [Trichoderma atroviride IMI 206040] Length = 51 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 11 QKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >ref|XP_006961218.1| ribosomal protein L39e [Trichoderma reesei QM6a] gi|340522031|gb|EGR52264.1| ribosomal protein L39e [Trichoderma reesei QM6a] gi|358387104|gb|EHK24699.1| hypothetical protein TRIVIDRAFT_91630 [Trichoderma virens Gv29-8] gi|572283488|gb|ETS06462.1| ribosomal protein L39e [Trichoderma reesei RUT C-30] Length = 51 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTRLGI Sbjct: 11 QKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >ref|XP_001229558.1| 60S ribosomal protein L39 [Chaetomium globosum CBS 148.51] gi|88183639|gb|EAQ91107.1| hypothetical protein CHGG_03042 [Chaetomium globosum CBS 148.51] Length = 51 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLG+ Sbjct: 11 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGL 51 >gb|ETN40271.1| 60S ribosomal protein L39 [Cyphellophora europaea CBS 101466] Length = 72 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 32 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 72 >gb|EMF12058.1| ribosomal protein L39e [Sphaerulina musiva SO2202] Length = 51 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 11 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >gb|EME82094.1| hypothetical protein MYCFIDRAFT_30141, partial [Pseudocercospora fijiensis CIRAD86] Length = 49 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 9 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 49 >ref|XP_003850033.1| 60S ribosomal protein L39 [Zymoseptoria tritici IPO323] gi|339469911|gb|EGP85009.1| hypothetical protein MYCGRDRAFT_105463 [Zymoseptoria tritici IPO323] gi|494829312|gb|EON66003.1| 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] Length = 51 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 11 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >ref|XP_001908102.1| hypothetical protein [Podospora anserina S mat+] gi|170943122|emb|CAP68775.1| unnamed protein product [Podospora anserina S mat+] Length = 51 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLG+ Sbjct: 11 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGL 51 >ref|XP_959018.2| 60S ribosomal protein L39 [Neurospora crassa OR74A] gi|367027608|ref|XP_003663088.1| hypothetical protein MYCTH_2315209 [Myceliophthora thermophila ATCC 42464] gi|157069957|gb|EAA29782.2| 60S ribosomal protein L39 [Neurospora crassa OR74A] gi|336470064|gb|EGO58226.1| 60S ribosomal protein L39 [Neurospora tetrasperma FGSC 2508] gi|347010357|gb|AEO57843.1| hypothetical protein MYCTH_2315209 [Myceliophthora thermophila ATCC 42464] gi|350290244|gb|EGZ71458.1| 60S ribosomal protein L39 [Neurospora tetrasperma FGSC 2509] gi|380094182|emb|CCC08399.1| unnamed protein product [Sordaria macrospora k-hell] Length = 51 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLG+ Sbjct: 11 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGL 51 >ref|XP_387097.1| hypothetical protein FG06921.1 [Fusarium graminearum PH-1] Length = 50 Score = 88.6 bits (218), Expect = 8e-16 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = +3 Query: 3 QKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 125 QKLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKTR+GI Sbjct: 10 QKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 50