BLASTX nr result
ID: Akebia23_contig00054873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00054873 (457 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003853575.1| hypothetical protein MYCGRDRAFT_92288 [Zymos... 70 3e-10 gb|EMC94802.1| hypothetical protein BAUCODRAFT_25915 [Baudoinia ... 63 5e-08 ref|XP_003836364.1| hypothetical protein LEMA_P039000.1 [Leptosp... 61 1e-07 gb|EKG18093.1| Zinc finger C2H2-type protein [Macrophomina phase... 58 1e-06 gb|EON66408.1| hypothetical protein W97_05505 [Coniosporium apol... 57 2e-06 >ref|XP_003853575.1| hypothetical protein MYCGRDRAFT_92288 [Zymoseptoria tritici IPO323] gi|339473457|gb|EGP88551.1| hypothetical protein MYCGRDRAFT_92288 [Zymoseptoria tritici IPO323] Length = 425 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -3 Query: 290 MLPGLEPMGAPSSFTSRRPNASHLPNFELPPPQLPAFQQKYGQ 162 M+PG + MGAP+SFT+RRPNASHLP+FELPPP L QQKY Q Sbjct: 1 MVPGPDSMGAPTSFTARRPNASHLPSFELPPPPLAGLQQKYHQ 43 >gb|EMC94802.1| hypothetical protein BAUCODRAFT_25915 [Baudoinia compniacensis UAMH 10762] Length = 421 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -3 Query: 290 MLPGLEPMGAPSSFTSRRPNASHLPNFELPPPQLPAFQQKY 168 M+PG E MGAP+S T RRPNAS+LP FELPPP L QKY Sbjct: 1 MVPGPESMGAPTSLTQRRPNASNLPQFELPPPHLSVLNQKY 41 >ref|XP_003836364.1| hypothetical protein LEMA_P039000.1 [Leptosphaeria maculans JN3] gi|312212917|emb|CBX92999.1| hypothetical protein LEMA_P039000.1 [Leptosphaeria maculans JN3] Length = 876 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -3 Query: 320 VAAAVAYTPHMLPGLEPMGAPSSFTSRRPNASHLPNFELPPPQL 189 VAAAVA+ M PG +PMGAP SF +RRP+A HL +FELPPP + Sbjct: 421 VAAAVAHPTSMHPGSDPMGAPPSFAARRPHAQHLGSFELPPPPM 464 >gb|EKG18093.1| Zinc finger C2H2-type protein [Macrophomina phaseolina MS6] Length = 412 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = -3 Query: 290 MLPGLEPMGAPSSFTSRRPNASHLPNFELPPPQLPAFQQ 174 M PG + MGAP+SFT+RRPNA LPNFELPPP L + Q+ Sbjct: 1 MHPGPDSMGAPTSFTARRPNAPSLPNFELPPPPLSSLQK 39 >gb|EON66408.1| hypothetical protein W97_05505 [Coniosporium apollinis CBS 100218] Length = 418 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 290 MLPGLEPMGAPSSFTSRRPNASHLPNFELPPPQLPAFQQ 174 M PG + +GAP SF +RRPNAS+LPNFELPPPQL + + Sbjct: 1 MHPGPDSLGAPPSFATRRPNASNLPNFELPPPQLSSLHK 39