BLASTX nr result
ID: Akebia23_contig00054474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00054474 (510 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324825.2| CCR4-NOT transcription complex family protei... 60 2e-07 ref|XP_002324241.2| hypothetical protein POPTR_0018s00911g [Popu... 59 7e-07 >ref|XP_002324825.2| CCR4-NOT transcription complex family protein, partial [Populus trichocarpa] gi|550317730|gb|EEF03390.2| CCR4-NOT transcription complex family protein, partial [Populus trichocarpa] Length = 301 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/54 (51%), Positives = 39/54 (72%) Frame = -2 Query: 167 RKKIFRIKETI*RYPYISIDIEFPGFLQNTP*DLSQLD**EDLKFNVDQLKIIQ 6 +++IFR+ + R+P +S D EFPGF +NTP D S L+ EDLK NVD L++IQ Sbjct: 17 QREIFRLDAALFRFPVVSFDTEFPGFFRNTPIDASDLNRYEDLKHNVDPLRLIQ 70 >ref|XP_002324241.2| hypothetical protein POPTR_0018s00911g [Populus trichocarpa] gi|550317754|gb|EEF02806.2| hypothetical protein POPTR_0018s00911g [Populus trichocarpa] Length = 305 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/54 (50%), Positives = 38/54 (70%) Frame = -2 Query: 167 RKKIFRIKETI*RYPYISIDIEFPGFLQNTP*DLSQLD**EDLKFNVDQLKIIQ 6 +++IFR+ + R+P +S D EFPGF +NTP D + L EDLK NVD L++IQ Sbjct: 20 KREIFRLDAALFRFPVVSFDTEFPGFFRNTPIDATDLTRYEDLKHNVDPLRLIQ 73