BLASTX nr result
ID: Akebia23_contig00054130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00054130 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCH50976.1| T4.15 [Malus x robusta] 62 1e-07 emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse tr... 62 1e-07 gb|EMS45856.1| Cystathionine gamma-synthase, chloroplastic [Trit... 61 2e-07 gb|EMT32377.1| Putative beta-1,3-galactosyltransferase 8 [Aegilo... 59 9e-07 gb|EMT14674.1| Methyltransferase-like protein 13 [Aegilops tausc... 59 9e-07 gb|EMT09105.1| Putative RNA-directed DNA polymerase from transpo... 59 9e-07 gb|EMS59319.1| V-type proton ATPase subunit B 2 [Triticum urartu] 59 9e-07 gb|EMS56299.1| Polycomb group protein EMBRYONIC FLOWER 2 [Tritic... 59 9e-07 gb|EMS53784.1| IAA-alanine resistance protein 1 [Triticum urartu] 59 9e-07 gb|EMS61456.1| Protein HASTY 1 [Triticum urartu] 56 5e-06 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = +1 Query: 172 RGIKLRSHIMKSWEIVMEYRLRQKTKISINKFGFMPRESIIKAVF 306 RGIKL SH MK WE V+E+RLRQ+T++S N+FGFMP S ++A++ Sbjct: 638 RGIKLMSHTMKLWERVIEHRLRQETRVSDNQFGFMPGRSTMEAIY 682 >emb|CBL94163.1| putative RNA-directed DNA polymerase (Reverse transcriptase) [Malus domestica] Length = 622 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/45 (60%), Positives = 37/45 (82%) Frame = +1 Query: 172 RGIKLRSHIMKSWEIVMEYRLRQKTKISINKFGFMPRESIIKAVF 306 RGIKL SH MK WE V+E+RLRQ+T++S N+FGFMP S ++A++ Sbjct: 242 RGIKLMSHTMKLWERVIEHRLRQETRVSDNQFGFMPGRSTMEAIY 286 >gb|EMS45856.1| Cystathionine gamma-synthase, chloroplastic [Triticum urartu] Length = 723 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +1 Query: 172 RGIKLRSHIMKSWEIVMEYRLRQKTKISINKFGFMPRESIIKAVF 306 RGIKL SHIMK WE V+E+RLR+ T ++ N+ GFMPR S ++A+F Sbjct: 424 RGIKLMSHIMKLWERVIEHRLRRMTSVTKNQLGFMPRRSTMEAIF 468 >gb|EMT32377.1| Putative beta-1,3-galactosyltransferase 8 [Aegilops tauschii] Length = 1379 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +1 Query: 172 RGIKLRSHIMKSWEIVMEYRLRQKTKISINKFGFMPRESIIKAVF 306 RGIKL SH MK WE V+E+RLR+ T ++ N+FGFMP S ++A+F Sbjct: 429 RGIKLMSHTMKLWERVIEHRLRRMTSVTKNQFGFMPGRSTMEAIF 473 >gb|EMT14674.1| Methyltransferase-like protein 13 [Aegilops tauschii] Length = 1134 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +1 Query: 172 RGIKLRSHIMKSWEIVMEYRLRQKTKISINKFGFMPRESIIKAVF 306 RGIKL SH MK WE V+E+RLR+ T ++ N+FGFMP S ++A+F Sbjct: 391 RGIKLMSHTMKLWERVIEHRLRRMTSVTKNQFGFMPGRSTMEAIF 435 >gb|EMT09105.1| Putative RNA-directed DNA polymerase from transposon BS [Aegilops tauschii] Length = 1476 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +1 Query: 172 RGIKLRSHIMKSWEIVMEYRLRQKTKISINKFGFMPRESIIKAVF 306 RGIKL SH MK WE V+E+RLR+ T ++ N+FGFMP S ++A+F Sbjct: 952 RGIKLMSHTMKLWERVIEHRLRRMTSVTKNQFGFMPGRSTMEAIF 996 >gb|EMS59319.1| V-type proton ATPase subunit B 2 [Triticum urartu] Length = 605 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +1 Query: 172 RGIKLRSHIMKSWEIVMEYRLRQKTKISINKFGFMPRESIIKAVF 306 RGIKL SH MK WE V+E+RLR+ T ++ N+FGFMP S ++A+F Sbjct: 61 RGIKLMSHTMKLWERVIEHRLRRMTSVTKNQFGFMPGRSTMEAIF 105 >gb|EMS56299.1| Polycomb group protein EMBRYONIC FLOWER 2 [Triticum urartu] Length = 974 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +1 Query: 172 RGIKLRSHIMKSWEIVMEYRLRQKTKISINKFGFMPRESIIKAVF 306 RGIKL SH MK WE V+E+RLR+ T ++ N+FGFMP S ++A+F Sbjct: 27 RGIKLMSHTMKLWERVIEHRLRRMTSVTKNQFGFMPGRSTMEAIF 71 >gb|EMS53784.1| IAA-alanine resistance protein 1 [Triticum urartu] Length = 722 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +1 Query: 172 RGIKLRSHIMKSWEIVMEYRLRQKTKISINKFGFMPRESIIKAVF 306 RGIKL SH MK WE V+E+RLR+ T ++ N+FGFMP S ++A+F Sbjct: 530 RGIKLMSHTMKLWERVIEHRLRRMTSVTKNQFGFMPGRSTMEAIF 574 >gb|EMS61456.1| Protein HASTY 1 [Triticum urartu] Length = 955 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +1 Query: 172 RGIKLRSHIMKSWEIVMEYRLRQKTKISINKFGFMPRESIIKAVF 306 RGIKL SH K WE V+E+RLR+ T ++ N+FGFMP S ++A+F Sbjct: 704 RGIKLTSHTTKLWERVIEHRLRRMTSVTKNQFGFMPGRSTMEAIF 748