BLASTX nr result
ID: Akebia23_contig00054058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00054058 (403 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531134.1| alanyl-tRNA synthetase, putative [Ricinus co... 62 1e-07 emb|CBI27126.3| unnamed protein product [Vitis vinifera] 57 3e-06 gb|EXC33093.1| Alanine--tRNA ligase [Morus notabilis] 57 3e-06 ref|XP_007225354.1| hypothetical protein PRUPE_ppa000923mg [Prun... 57 3e-06 ref|XP_002277341.1| PREDICTED: alanyl-tRNA synthetase-like [Viti... 57 3e-06 ref|XP_006484669.1| PREDICTED: alanine--tRNA ligase-like isoform... 56 4e-06 ref|XP_006484668.1| PREDICTED: alanine--tRNA ligase-like isoform... 56 4e-06 ref|XP_006437524.1| hypothetical protein CICLE_v10030624mg [Citr... 56 4e-06 ref|XP_007043323.1| Alanyl-tRNA synthetase, putative [Theobroma ... 56 4e-06 ref|XP_004163302.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRN... 56 4e-06 ref|XP_004148575.1| PREDICTED: alanine--tRNA ligase-like [Cucumi... 56 4e-06 ref|XP_006826671.1| hypothetical protein AMTR_s00137p00047050 [A... 56 6e-06 ref|XP_006347609.1| PREDICTED: alanine--tRNA ligase-like [Solanu... 55 1e-05 ref|XP_004235270.1| PREDICTED: alanine--tRNA ligase-like [Solanu... 55 1e-05 emb|CBI26461.3| unnamed protein product [Vitis vinifera] 55 1e-05 >ref|XP_002531134.1| alanyl-tRNA synthetase, putative [Ricinus communis] gi|223529283|gb|EEF31254.1| alanyl-tRNA synthetase, putative [Ricinus communis] Length = 1025 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 81 CLQDAFVLWDTYGFPLDLTQLMAEERG 1 CLQDAFVLWDTYGFPLDLTQLMAEERG Sbjct: 481 CLQDAFVLWDTYGFPLDLTQLMAEERG 507 >emb|CBI27126.3| unnamed protein product [Vitis vinifera] Length = 1026 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -2 Query: 96 LYEYLCLQDAFVLWDTYGFPLDLTQLMAEERG 1 L + ++DAFVLWDTYGFPLDLTQLMAEERG Sbjct: 477 LVSLMIIKDAFVLWDTYGFPLDLTQLMAEERG 508 >gb|EXC33093.1| Alanine--tRNA ligase [Morus notabilis] Length = 906 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 75 QDAFVLWDTYGFPLDLTQLMAEERG 1 QDAFVLWDTYGFPLDLTQLMAEERG Sbjct: 364 QDAFVLWDTYGFPLDLTQLMAEERG 388 >ref|XP_007225354.1| hypothetical protein PRUPE_ppa000923mg [Prunus persica] gi|462422290|gb|EMJ26553.1| hypothetical protein PRUPE_ppa000923mg [Prunus persica] Length = 960 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 75 QDAFVLWDTYGFPLDLTQLMAEERG 1 QDAFVLWDTYGFPLDLTQLMAEERG Sbjct: 420 QDAFVLWDTYGFPLDLTQLMAEERG 444 >ref|XP_002277341.1| PREDICTED: alanyl-tRNA synthetase-like [Vitis vinifera] Length = 1002 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 75 QDAFVLWDTYGFPLDLTQLMAEERG 1 QDAFVLWDTYGFPLDLTQLMAEERG Sbjct: 460 QDAFVLWDTYGFPLDLTQLMAEERG 484 >ref|XP_006484669.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Citrus sinensis] Length = 1002 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 75 QDAFVLWDTYGFPLDLTQLMAEERG 1 QDAF+LWDTYGFPLDLTQLMAEERG Sbjct: 460 QDAFILWDTYGFPLDLTQLMAEERG 484 >ref|XP_006484668.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Citrus sinensis] Length = 1009 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 75 QDAFVLWDTYGFPLDLTQLMAEERG 1 QDAF+LWDTYGFPLDLTQLMAEERG Sbjct: 460 QDAFILWDTYGFPLDLTQLMAEERG 484 >ref|XP_006437524.1| hypothetical protein CICLE_v10030624mg [Citrus clementina] gi|557539720|gb|ESR50764.1| hypothetical protein CICLE_v10030624mg [Citrus clementina] Length = 1001 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 75 QDAFVLWDTYGFPLDLTQLMAEERG 1 QDAF+LWDTYGFPLDLTQLMAEERG Sbjct: 460 QDAFILWDTYGFPLDLTQLMAEERG 484 >ref|XP_007043323.1| Alanyl-tRNA synthetase, putative [Theobroma cacao] gi|508707258|gb|EOX99154.1| Alanyl-tRNA synthetase, putative [Theobroma cacao] Length = 1015 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 75 QDAFVLWDTYGFPLDLTQLMAEERG 1 QDAF+LWDTYGFPLDLTQLMAEERG Sbjct: 469 QDAFILWDTYGFPLDLTQLMAEERG 493 >ref|XP_004163302.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase-like [Cucumis sativus] Length = 956 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 75 QDAFVLWDTYGFPLDLTQLMAEERG 1 QDAF+LWDTYGFPLDLTQLMAEERG Sbjct: 413 QDAFILWDTYGFPLDLTQLMAEERG 437 >ref|XP_004148575.1| PREDICTED: alanine--tRNA ligase-like [Cucumis sativus] Length = 956 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 75 QDAFVLWDTYGFPLDLTQLMAEERG 1 QDAF+LWDTYGFPLDLTQLMAEERG Sbjct: 413 QDAFILWDTYGFPLDLTQLMAEERG 437 >ref|XP_006826671.1| hypothetical protein AMTR_s00137p00047050 [Amborella trichopoda] gi|548831072|gb|ERM93908.1| hypothetical protein AMTR_s00137p00047050 [Amborella trichopoda] Length = 996 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 75 QDAFVLWDTYGFPLDLTQLMAEERG 1 QDAFVLWDTYGFP+DLTQLMAEERG Sbjct: 455 QDAFVLWDTYGFPMDLTQLMAEERG 479 >ref|XP_006347609.1| PREDICTED: alanine--tRNA ligase-like [Solanum tuberosum] Length = 1009 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 75 QDAFVLWDTYGFPLDLTQLMAEERG 1 Q+AFVLWDTYGFPLDLTQLMAEERG Sbjct: 467 QEAFVLWDTYGFPLDLTQLMAEERG 491 >ref|XP_004235270.1| PREDICTED: alanine--tRNA ligase-like [Solanum lycopersicum] Length = 1010 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 75 QDAFVLWDTYGFPLDLTQLMAEERG 1 Q+AFVLWDTYGFPLDLTQLMAEERG Sbjct: 468 QEAFVLWDTYGFPLDLTQLMAEERG 492 >emb|CBI26461.3| unnamed protein product [Vitis vinifera] Length = 960 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 75 QDAFVLWDTYGFPLDLTQLMAEERG 1 Q+AFVLWDTYGFPLDLTQLMAEERG Sbjct: 418 QEAFVLWDTYGFPLDLTQLMAEERG 442