BLASTX nr result
ID: Akebia23_contig00054009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00054009 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT40504.2| Polyprotein, putative [Solanum demissum] 59 7e-07 gb|EMS56680.1| MutS protein-like protein 5 [Triticum urartu] 56 6e-06 >gb|AAT40504.2| Polyprotein, putative [Solanum demissum] Length = 868 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = +2 Query: 206 VIDDITAPIQEQVP*CLLFANDVVLDDEIRERVNTKLDFWRDELE 340 V+D++T IQE VP C+LFA+D+VL DE R+RVN +L+ WR LE Sbjct: 419 VMDELTRSIQETVPWCMLFADDIVLIDETRDRVNARLEVWRQTLE 463 >gb|EMS56680.1| MutS protein-like protein 5 [Triticum urartu] Length = 1140 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +2 Query: 206 VIDDITAPIQEQVP*CLLFANDVVLDDEIRERVNTKLDFWRDELE 340 V+D++T IQ +P C+LFA DVVLDD+ R VN KL+ WR LE Sbjct: 585 VMDEVTRDIQGDIPWCMLFAEDVVLDDDSRTGVNRKLELWRQTLE 629