BLASTX nr result
ID: Akebia23_contig00053988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00053988 (394 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC96494.1| hypothetical protein BAUCODRAFT_70359 [Baudoinia ... 79 9e-13 >gb|EMC96494.1| hypothetical protein BAUCODRAFT_70359 [Baudoinia compniacensis UAMH 10762] Length = 305 Score = 78.6 bits (192), Expect = 9e-13 Identities = 38/58 (65%), Positives = 39/58 (67%), Gaps = 6/58 (10%) Frame = -1 Query: 337 HDTRPSHEXXXXXXXXXXXXTAAYDKVDGH------GTHGGYYTQPQGTGVNPYGYDN 182 HDTRPSHE TA+YDKVD H GTHGGYYTQPQGTGVNPYGYDN Sbjct: 238 HDTRPSHETGYTGSTVAAPGTASYDKVDAHHGHQPHGTHGGYYTQPQGTGVNPYGYDN 295