BLASTX nr result
ID: Akebia23_contig00053956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00053956 (251 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EQB44136.1| hypothetical protein CGLO_17135 [Colletotrichum g... 59 5e-07 ref|XP_007280581.1| peptidase s41 family protein [Colletotrichum... 57 3e-06 >gb|EQB44136.1| hypothetical protein CGLO_17135 [Colletotrichum gloeosporioides Cg-14] Length = 814 Score = 59.3 bits (142), Expect = 5e-07 Identities = 37/63 (58%), Positives = 41/63 (65%), Gaps = 3/63 (4%) Frame = -2 Query: 250 TNLWKAAATAAFKGGDCAAGAID--STVPTTRR-ASRPAVPWKPRYTAPRKETKDLRTPI 80 TNLWKAAATAAFKGG CA G ID ST T+R A RPA +PR P+ K R P+ Sbjct: 734 TNLWKAAATAAFKGGKCAFGGIDYASTGSATKRTAERPAPFNRPRIGIPKGVPK--RVPV 791 Query: 79 AKR 71 AKR Sbjct: 792 AKR 794 >ref|XP_007280581.1| peptidase s41 family protein [Colletotrichum gloeosporioides Nara gc5] gi|429855414|gb|ELA30370.1| peptidase s41 family protein [Colletotrichum gloeosporioides Nara gc5] Length = 784 Score = 57.0 bits (136), Expect = 3e-06 Identities = 36/63 (57%), Positives = 40/63 (63%), Gaps = 3/63 (4%) Frame = -2 Query: 250 TNLWKAAATAAFKGGDCAAGAID--STVPTTRR-ASRPAVPWKPRYTAPRKETKDLRTPI 80 TNLWKAAATAAFKGG CA G ID ST +R A RPA +PR P+ K R P+ Sbjct: 704 TNLWKAAATAAFKGGKCAFGGIDYASTGSAKKRTAERPAPFNRPRIGIPKGVPK--RVPV 761 Query: 79 AKR 71 AKR Sbjct: 762 AKR 764