BLASTX nr result
ID: Akebia23_contig00053730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00053730 (227 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG21412.1| Porin eukaryotic type [Macrophomina phaseolina MS6] 89 6e-16 ref|XP_003835324.1| similar to Mitochondrial porin (voltage-depe... 89 8e-16 ref|XP_003295494.1| hypothetical protein PTT_01274 [Pyrenophora ... 87 2e-15 ref|XP_001795336.1| hypothetical protein SNOG_04923 [Phaeosphaer... 87 2e-15 gb|EMD97813.1| hypothetical protein COCHEDRAFT_1125725 [Bipolari... 86 5e-15 gb|EMD60154.1| hypothetical protein COCSADRAFT_40587 [Bipolaris ... 86 5e-15 gb|EOA85817.1| hypothetical protein SETTUDRAFT_169595 [Setosphae... 84 2e-14 ref|XP_007582417.1| putative outer mitochondrial membrane protei... 81 1e-13 gb|EON68853.1| hypothetical protein W97_08111 [Coniosporium apol... 79 9e-13 gb|EZF33785.1| mitochondrial outer membrane protein porin [Trich... 77 2e-12 gb|EZF22395.1| hypothetical protein H100_04839 [Trichophyton rub... 77 2e-12 ref|XP_003177798.1| outer mitochondrial membrane protein porin [... 77 2e-12 ref|XP_002851216.1| outer mitochondrial membrane protein porin [... 77 2e-12 ref|XP_662006.1| hypothetical protein AN4402.2 [Aspergillus nidu... 75 7e-12 ref|XP_002622715.1| outer mitochondrial membrane protein porin [... 74 2e-11 ref|XP_001267336.1| outer mitochondrial membrane protein porin [... 74 2e-11 ref|XP_002584873.1| outer mitochondrial membrane protein porin [... 74 3e-11 gb|EXJ86154.1| hypothetical protein A1O1_06524 [Capronia coronat... 73 5e-11 ref|XP_002790265.1| outer mitochondrial membrane protein porin [... 73 5e-11 gb|EXJ71617.1| hypothetical protein A1O5_05425 [Cladophialophora... 72 6e-11 >gb|EKG21412.1| Porin eukaryotic type [Macrophomina phaseolina MS6] Length = 284 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/71 (56%), Positives = 53/71 (74%) Frame = -3 Query: 213 MAVPAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAK 34 M+VPA+SDI K AND++NKDFYH E+KLK+P+G+++ KGTS H G I+ S E K Sbjct: 1 MSVPAFSDIPKSANDLLNKDFYHAAAAVLEVKLKSPNGVAVTTKGTSAHDGPINGSVEGK 60 Query: 33 KVIAKGITVTE 1 K ++ GITVTE Sbjct: 61 KALSNGITVTE 71 >ref|XP_003835324.1| similar to Mitochondrial porin (voltage-dependent anion channel) [Leptosphaeria maculans JN3] gi|312211875|emb|CBX91959.1| similar to Mitochondrial porin (voltage-dependent anion channel) [Leptosphaeria maculans JN3] Length = 297 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/68 (60%), Positives = 53/68 (77%) Frame = -3 Query: 204 PAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKKVI 25 PA+SDIAK +ND+INKDFYH A E+KLKAP+G++ AKGTS H G +SSS E KK I Sbjct: 17 PAFSDIAKASNDLINKDFYHTAAAALEVKLKAPNGVNFTAKGTSAHDGPVSSSLEGKKAI 76 Query: 24 AKGITVTE 1 + GI++T+ Sbjct: 77 SNGISITQ 84 >ref|XP_003295494.1| hypothetical protein PTT_01274 [Pyrenophora teres f. teres 0-1] gi|311333188|gb|EFQ96412.1| hypothetical protein PTT_01274 [Pyrenophora teres f. teres 0-1] Length = 297 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/68 (58%), Positives = 53/68 (77%) Frame = -3 Query: 204 PAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKKVI 25 PA+SDIAK +ND+INKDFYH A E+KLKAP+G++ AKGTS H G ++SS E KK + Sbjct: 17 PAFSDIAKASNDLINKDFYHTAAAALEVKLKAPNGVNFTAKGTSAHDGPVTSSLEGKKSL 76 Query: 24 AKGITVTE 1 A GI++T+ Sbjct: 77 ANGISITQ 84 >ref|XP_001795336.1| hypothetical protein SNOG_04923 [Phaeosphaeria nodorum SN15] gi|160706463|gb|EAT87314.2| hypothetical protein SNOG_04923 [Phaeosphaeria nodorum SN15] Length = 152 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/68 (57%), Positives = 54/68 (79%) Frame = -3 Query: 204 PAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKKVI 25 PA+SDIAK +ND+INKDFYH A E+KLKAP+G++ AKGTS H+G ++SS E KK + Sbjct: 17 PAFSDIAKASNDLINKDFYHTAAAALEVKLKAPNGVNFTAKGTSAHNGPVTSSLEGKKAL 76 Query: 24 AKGITVTE 1 + GI++T+ Sbjct: 77 SNGISITQ 84 >gb|EMD97813.1| hypothetical protein COCHEDRAFT_1125725 [Bipolaris maydis C5] gi|477585704|gb|ENI02791.1| hypothetical protein COCC4DRAFT_200867 [Bipolaris maydis ATCC 48331] Length = 297 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/68 (57%), Positives = 53/68 (77%) Frame = -3 Query: 204 PAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKKVI 25 PA+SDIAK +ND+INKDFYH A E+KLKAP+G++ AKGTS H G ++SS E KK + Sbjct: 17 PAFSDIAKASNDLINKDFYHTAAAALEVKLKAPNGVNFTAKGTSAHDGPVTSSLEGKKSL 76 Query: 24 AKGITVTE 1 + GI++T+ Sbjct: 77 SNGISITQ 84 >gb|EMD60154.1| hypothetical protein COCSADRAFT_40587 [Bipolaris sorokiniana ND90Pr] gi|576917968|gb|EUC32176.1| hypothetical protein COCCADRAFT_99332 [Bipolaris zeicola 26-R-13] gi|576936565|gb|EUC50059.1| hypothetical protein COCMIDRAFT_83011 [Bipolaris oryzae ATCC 44560] gi|578489989|gb|EUN27409.1| hypothetical protein COCVIDRAFT_98325 [Bipolaris victoriae FI3] Length = 297 Score = 85.9 bits (211), Expect = 5e-15 Identities = 39/68 (57%), Positives = 53/68 (77%) Frame = -3 Query: 204 PAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKKVI 25 PA+SDIAK +ND+INKDFYH A E+KLKAP+G++ AKGTS H G ++SS E KK + Sbjct: 17 PAFSDIAKASNDLINKDFYHTAAAALEVKLKAPNGVNFTAKGTSAHDGPVTSSLEGKKSL 76 Query: 24 AKGITVTE 1 + GI++T+ Sbjct: 77 SNGISITQ 84 >gb|EOA85817.1| hypothetical protein SETTUDRAFT_169595 [Setosphaeria turcica Et28A] Length = 297 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/68 (55%), Positives = 52/68 (76%) Frame = -3 Query: 204 PAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKKVI 25 PA+SDI+K +ND+INKDFYH A E+KLKAP+G++ AKGTS H G ++SS E KK + Sbjct: 17 PAFSDISKASNDLINKDFYHTAAAALEVKLKAPNGVNFTAKGTSAHDGPVTSSLEGKKSL 76 Query: 24 AKGITVTE 1 GI++T+ Sbjct: 77 PNGISITQ 84 >ref|XP_007582417.1| putative outer mitochondrial membrane protein porin protein [Neofusicoccum parvum UCRNP2] gi|485925562|gb|EOD50101.1| putative outer mitochondrial membrane protein porin protein [Neofusicoccum parvum UCRNP2] Length = 333 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/69 (52%), Positives = 51/69 (73%) Frame = -3 Query: 213 MAVPAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAK 34 M+VPA+SDI K AND++NKDFYH E+KLK+P+G+++ KGTS H G I+ S E K Sbjct: 1 MSVPAFSDIPKSANDLLNKDFYHAAAAVLEVKLKSPNGVAVTTKGTSAHDGPINGSVEGK 60 Query: 33 KVIAKGITV 7 K ++ GI++ Sbjct: 61 KGLSNGISL 69 >gb|EON68853.1| hypothetical protein W97_08111 [Coniosporium apollinis CBS 100218] Length = 376 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/65 (53%), Positives = 47/65 (72%) Frame = -3 Query: 207 VPAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKKV 28 VPA++DI+K AND++NKDFYH E+KLKAP+G++ KGTS H S S EAKK+ Sbjct: 47 VPAFTDISKSANDILNKDFYHALAANLEVKLKAPNGVAFTTKGTSTHDSATSGSVEAKKL 106 Query: 27 IAKGI 13 ++ GI Sbjct: 107 LSNGI 111 >gb|EZF33785.1| mitochondrial outer membrane protein porin [Trichophyton interdigitale H6] Length = 345 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/71 (54%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Frame = -3 Query: 210 AVPAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKK 31 A AYSDIAK AND++NKDFYH + E+K KAP+G++ N KG S H G+I+ S EAK Sbjct: 3 APAAYSDIAKAANDLLNKDFYHTSPASLEVKSKAPNGVTFNVKGKSAHEGSIAGSLEAKY 62 Query: 30 VIA-KGITVTE 1 V A G+T+T+ Sbjct: 63 VDAPSGLTLTQ 73 >gb|EZF22395.1| hypothetical protein H100_04839 [Trichophyton rubrum MR850] gi|607904098|gb|EZF41544.1| hypothetical protein H102_04823 [Trichophyton rubrum CBS 100081] gi|607916118|gb|EZF52116.1| hypothetical protein H103_04828 [Trichophyton rubrum CBS 288.86] gi|607928027|gb|EZF62580.1| hypothetical protein H104_04817 [Trichophyton rubrum CBS 289.86] gi|607939979|gb|EZF73229.1| hypothetical protein H105_04845 [Trichophyton soudanense CBS 452.61] gi|607952146|gb|EZF84021.1| hypothetical protein H110_04825 [Trichophyton rubrum MR1448] gi|607964242|gb|EZF94661.1| hypothetical protein H113_04867 [Trichophyton rubrum MR1459] gi|607971213|gb|EZG00656.1| hypothetical protein H106_08887 [Trichophyton rubrum CBS 735.88] gi|607988138|gb|EZG16128.1| hypothetical protein H107_04958 [Trichophyton rubrum CBS 202.88] Length = 254 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/71 (54%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Frame = -3 Query: 210 AVPAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKK 31 A AYSDIAK AND++NKDFYH + E+K KAP+G++ N KG S H G+I+ S EAK Sbjct: 3 APAAYSDIAKAANDLLNKDFYHTSPASLEVKSKAPNGVTFNVKGKSAHEGSIAGSLEAKY 62 Query: 30 VIA-KGITVTE 1 V A G+T+T+ Sbjct: 63 VDAPSGLTLTQ 73 >ref|XP_003177798.1| outer mitochondrial membrane protein porin [Arthroderma gypseum CBS 118893] gi|311339644|gb|EFQ98846.1| outer mitochondrial membrane protein porin [Arthroderma gypseum CBS 118893] gi|607877249|gb|EZF22394.1| hypothetical protein H100_04839 [Trichophyton rubrum MR850] gi|607904097|gb|EZF41543.1| hypothetical protein H102_04823 [Trichophyton rubrum CBS 100081] gi|607916117|gb|EZF52115.1| hypothetical protein H103_04828 [Trichophyton rubrum CBS 288.86] gi|607928026|gb|EZF62579.1| hypothetical protein H104_04817 [Trichophyton rubrum CBS 289.86] gi|607939978|gb|EZF73228.1| hypothetical protein H105_04845 [Trichophyton soudanense CBS 452.61] gi|607952145|gb|EZF84020.1| hypothetical protein H110_04825 [Trichophyton rubrum MR1448] gi|607964241|gb|EZF94660.1| hypothetical protein H113_04867 [Trichophyton rubrum MR1459] gi|607971212|gb|EZG00655.1| hypothetical protein H106_08887 [Trichophyton rubrum CBS 735.88] gi|607988137|gb|EZG16127.1| hypothetical protein H107_04958 [Trichophyton rubrum CBS 202.88] Length = 284 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/71 (54%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Frame = -3 Query: 210 AVPAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKK 31 A AYSDIAK AND++NKDFYH + E+K KAP+G++ N KG S H G+I+ S EAK Sbjct: 3 APAAYSDIAKAANDLLNKDFYHTSPASLEVKSKAPNGVTFNVKGKSAHEGSIAGSLEAKY 62 Query: 30 VIA-KGITVTE 1 V A G+T+T+ Sbjct: 63 VDAPSGLTLTQ 73 >ref|XP_002851216.1| outer mitochondrial membrane protein porin [Arthroderma otae CBS 113480] gi|238838770|gb|EEQ28432.1| outer mitochondrial membrane protein porin [Arthroderma otae CBS 113480] Length = 284 Score = 77.4 bits (189), Expect = 2e-12 Identities = 39/71 (54%), Positives = 51/71 (71%), Gaps = 1/71 (1%) Frame = -3 Query: 210 AVPAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKK 31 A AYSDIAK AND++NKDFYH + E+K KAP+G++ N KG S H G+I+ S EAK Sbjct: 3 APAAYSDIAKAANDLLNKDFYHTSPASLEVKSKAPNGVTFNVKGKSAHEGSIAGSLEAKY 62 Query: 30 VIA-KGITVTE 1 V A G+T+T+ Sbjct: 63 VDAPSGLTLTQ 73 >ref|XP_662006.1| hypothetical protein AN4402.2 [Aspergillus nidulans FGSC A4] gi|40741129|gb|EAA60319.1| hypothetical protein AN4402.2 [Aspergillus nidulans FGSC A4] gi|259482787|tpe|CBF77600.1| TPA: outer mitochondrial membrane protein porin (AFU_orthologue; AFUA_4G06910) [Aspergillus nidulans FGSC A4] Length = 284 Score = 75.5 bits (184), Expect = 7e-12 Identities = 40/73 (54%), Positives = 52/73 (71%), Gaps = 2/73 (2%) Frame = -3 Query: 213 MAVPA-YSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEA 37 MA PA +SDIAK AND++NKDFYH + E+K KAP+G++ N KG S H G I+ S EA Sbjct: 1 MAAPAAFSDIAKAANDLLNKDFYHGSAASLEVKSKAPNGVTFNVKGKSAHEGPIAGSLEA 60 Query: 36 KKVIA-KGITVTE 1 K V A G+T+T+ Sbjct: 61 KYVDAPTGLTLTQ 73 >ref|XP_002622715.1| outer mitochondrial membrane protein porin [Ajellomyces dermatitidis SLH14081] gi|239589197|gb|EEQ71840.1| outer mitochondrial membrane protein porin [Ajellomyces dermatitidis SLH14081] gi|239610269|gb|EEQ87256.1| outer mitochondrial membrane protein porin [Ajellomyces dermatitidis ER-3] gi|327357969|gb|EGE86826.1| outer mitochondrial membrane protein porin 1 [Ajellomyces dermatitidis ATCC 18188] gi|531979703|gb|EQL30290.1| mitochondrial outer membrane protein porin [Ajellomyces dermatitidis ATCC 26199] Length = 284 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/71 (53%), Positives = 49/71 (69%), Gaps = 1/71 (1%) Frame = -3 Query: 210 AVPAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKK 31 A A+SDIAK AND++NKDFYH E+K KAP+G++ N KG S H G I+ S EAK Sbjct: 3 APAAFSDIAKAANDLLNKDFYHASAANIEVKSKAPNGVTFNVKGKSAHEGPINGSLEAKY 62 Query: 30 VIA-KGITVTE 1 V A G+T+T+ Sbjct: 63 VDAPTGLTLTQ 73 >ref|XP_001267336.1| outer mitochondrial membrane protein porin [Neosartorya fischeri NRRL 181] gi|119415501|gb|EAW25439.1| outer mitochondrial membrane protein porin [Neosartorya fischeri NRRL 181] Length = 284 Score = 74.3 bits (181), Expect = 2e-11 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 1/71 (1%) Frame = -3 Query: 210 AVPAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKK 31 A A+SDIAK AND++NKDFYH + E+K KAP+G++ N KG S H G I+ S EAK Sbjct: 3 APAAFSDIAKAANDLLNKDFYHTSAASLEVKSKAPNGVTFNVKGKSAHEGPIAGSLEAKY 62 Query: 30 V-IAKGITVTE 1 V + G+T+T+ Sbjct: 63 VDLPTGLTLTQ 73 >ref|XP_002584873.1| outer mitochondrial membrane protein porin [Uncinocarpus reesii 1704] gi|237906319|gb|EEP80720.1| outer mitochondrial membrane protein porin [Uncinocarpus reesii 1704] Length = 284 Score = 73.6 bits (179), Expect = 3e-11 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 2/73 (2%) Frame = -3 Query: 213 MAVPA-YSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEA 37 MA PA + DIAK ND++NKDFYH + E+K KAP+G++ N KG S H G IS S EA Sbjct: 1 MAAPAAFGDIAKTVNDLLNKDFYHTSAASLEVKSKAPNGVTFNVKGKSAHEGPISGSLEA 60 Query: 36 KKVIA-KGITVTE 1 K V A G+T+T+ Sbjct: 61 KYVDAPTGLTLTQ 73 >gb|EXJ86154.1| hypothetical protein A1O1_06524 [Capronia coronata CBS 617.96] Length = 285 Score = 72.8 bits (177), Expect = 5e-11 Identities = 39/75 (52%), Positives = 50/75 (66%), Gaps = 1/75 (1%) Frame = -3 Query: 222 LSIMAVPAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSF 43 +S + VP +SDIAKPAND++NKDFYH E+K KAP+G+ N KG S H G IS S Sbjct: 1 MSGIPVP-FSDIAKPANDLLNKDFYHTTAANLEVKSKAPNGVVFNVKGKSAHDGPISGSI 59 Query: 42 EAKKV-IAKGITVTE 1 E K A G+T+T+ Sbjct: 60 EGKYADKATGLTLTQ 74 >ref|XP_002790265.1| outer mitochondrial membrane protein porin [Paracoccidioides sp. 'lutzii' Pb01] gi|226281717|gb|EEH37283.1| outer mitochondrial membrane protein porin [Paracoccidioides sp. 'lutzii' Pb01] Length = 284 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/71 (50%), Positives = 49/71 (69%), Gaps = 1/71 (1%) Frame = -3 Query: 210 AVPAYSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKK 31 A PA+SDIAK AND++NKDFYH E+K KAP+G++ + KG S H G IS S E+K Sbjct: 3 APPAFSDIAKAANDLLNKDFYHTSAANLEVKSKAPNGVTFHVKGKSAHEGPISGSLESKY 62 Query: 30 V-IAKGITVTE 1 V + G+T+ + Sbjct: 63 VDMPTGLTMIQ 73 >gb|EXJ71617.1| hypothetical protein A1O5_05425 [Cladophialophora psammophila CBS 110553] Length = 285 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/67 (53%), Positives = 45/67 (67%), Gaps = 1/67 (1%) Frame = -3 Query: 198 YSDIAKPANDVINKDFYHXXXXAFELKLKAPDGLSINAKGTSPHSGNISSSFEAKKV-IA 22 +SDIAKPAND++NKDFYH E+K KAP+G+ N KG S H G IS S E K A Sbjct: 8 FSDIAKPANDLLNKDFYHTTAANLEVKSKAPNGVVFNVKGKSAHDGPISGSIEGKYTDKA 67 Query: 21 KGITVTE 1 G+T+T+ Sbjct: 68 TGLTLTQ 74