BLASTX nr result
ID: Akebia23_contig00053435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00053435 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ62388.1| hypothetical protein BGT96224_2198 [Blumeria gram... 100 2e-19 gb|EXJ68231.1| hypothetical protein A1O5_08846 [Cladophialophora... 99 6e-19 gb|EHK97977.1| putative protein UPS2, mitochondrial [Glarea lozo... 99 6e-19 ref|XP_003848218.1| hypothetical protein MYCGRDRAFT_77228 [Zymos... 99 8e-19 ref|XP_752232.1| mitochondrial protein sorting (Msf1) [Aspergill... 98 1e-18 gb|ELR08654.1| hypothetical protein GMDG_03340 [Pseudogymnoascus... 98 1e-18 ref|XP_001595629.1| hypothetical protein SS1G_03718 [Sclerotinia... 98 1e-18 ref|XP_001267426.1| mitochondrial protein sorting (Msf1), putati... 98 1e-18 gb|EXJ85060.1| hypothetical protein A1O3_05735 [Capronia epimyce... 97 2e-18 gb|ESZ97409.1| protein MSF1 [Sclerotinia borealis F-4157] 97 2e-18 gb|EFX04358.1| mitochondrial protein sorting [Grosmannia clavige... 97 2e-18 ref|XP_001554449.1| hypothetical protein BC1G_07037 [Botryotinia... 97 2e-18 gb|EKV05289.1| Mitochondrial protein sorting (Msf1), putative [P... 97 3e-18 ref|XP_001271481.1| mitochondrial protein sorting (Msf1), putati... 97 3e-18 gb|ETS80995.1| hypothetical protein PFICI_05997 [Pestalotiopsis ... 96 4e-18 gb|EGY19825.1| MSF1 protein [Verticillium dahliae VdLs.17] 96 4e-18 ref|XP_003007521.1| MSF1 [Verticillium alfalfae VaMs.102] gi|261... 96 4e-18 gb|EKG21567.1| PRELI/MSF1 domain-containing protein [Macrophomin... 96 5e-18 ref|XP_001911789.1| hypothetical protein [Podospora anserina S m... 96 5e-18 gb|ERT02957.1| hypothetical protein HMPREF1624_01261 [Sporothrix... 96 7e-18 >gb|EPQ62388.1| hypothetical protein BGT96224_2198 [Blumeria graminis f. sp. tritici 96224] gi|528295360|emb|CCU78370.1| mitochondrial protein sorting (Msf1) [Blumeria graminis f. sp. hordei DH14] Length = 183 Score = 100 bits (250), Expect = 2e-19 Identities = 44/55 (80%), Positives = 49/55 (89%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FS++ FDYSWEEVSTANW KY PWNDKSTHVIAVDTI R+VDP +GILRTE Sbjct: 1 MKVFSNEENFDYSWEEVSTANWMKYCPWNDKSTHVIAVDTISRNVDPETGILRTE 55 >gb|EXJ68231.1| hypothetical protein A1O5_08846 [Cladophialophora psammophila CBS 110553] Length = 192 Score = 99.0 bits (245), Expect = 6e-19 Identities = 42/55 (76%), Positives = 49/55 (89%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MKIFSS + FDYSWEEVST NW+KY PWNDK++HV+AVDTI RH+DP +GILRTE Sbjct: 1 MKIFSSSYTFDYSWEEVSTNNWRKYCPWNDKASHVLAVDTISRHIDPQTGILRTE 55 >gb|EHK97977.1| putative protein UPS2, mitochondrial [Glarea lozoyensis 74030] gi|512207165|gb|EPE35983.1| hypothetical protein GLAREA_05321 [Glarea lozoyensis ATCC 20868] Length = 190 Score = 99.0 bits (245), Expect = 6e-19 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FS++ FDYSWEEVSTANW+KY PWNDKSTHVIAVDT+ R VD T+GILRTE Sbjct: 1 MKVFSNEESFDYSWEEVSTANWRKYCPWNDKSTHVIAVDTLSRSVDTTTGILRTE 55 >ref|XP_003848218.1| hypothetical protein MYCGRDRAFT_77228 [Zymoseptoria tritici IPO323] gi|339468092|gb|EGP83194.1| hypothetical protein MYCGRDRAFT_77228 [Zymoseptoria tritici IPO323] Length = 192 Score = 98.6 bits (244), Expect = 8e-19 Identities = 43/55 (78%), Positives = 48/55 (87%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK FSS HEF YSW+EVSTANW+KY PWNDKSTHVIAVDT+ R + PT+GILRTE Sbjct: 1 MKFFSSSHEFAYSWDEVSTANWRKYCPWNDKSTHVIAVDTLSRSLSPTTGILRTE 55 >ref|XP_752232.1| mitochondrial protein sorting (Msf1) [Aspergillus fumigatus Af293] gi|66849866|gb|EAL90194.1| mitochondrial protein sorting (Msf1), putative [Aspergillus fumigatus Af293] gi|159124853|gb|EDP49970.1| mitochondrial protein sorting (Msf1), putative [Aspergillus fumigatus A1163] Length = 190 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/55 (80%), Positives = 48/55 (87%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FSS FDYSWEEVSTANW+KY PWNDKSTHV+AVDTI R VDP +GILRTE Sbjct: 1 MKVFSSTCTFDYSWEEVSTANWRKYCPWNDKSTHVVAVDTISRTVDPKTGILRTE 55 >gb|ELR08654.1| hypothetical protein GMDG_03340 [Pseudogymnoascus destructans 20631-21] Length = 185 Score = 98.2 bits (243), Expect = 1e-18 Identities = 43/55 (78%), Positives = 48/55 (87%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FS+ FDYSWEEVSTANW+KY PWNDKSTHVIAVDT+ RHVD +GILRTE Sbjct: 1 MKVFSNSCNFDYSWEEVSTANWRKYCPWNDKSTHVIAVDTLSRHVDSDTGILRTE 55 >ref|XP_001595629.1| hypothetical protein SS1G_03718 [Sclerotinia sclerotiorum 1980] gi|154701505|gb|EDO01244.1| hypothetical protein SS1G_03718 [Sclerotinia sclerotiorum 1980 UF-70] Length = 188 Score = 98.2 bits (243), Expect = 1e-18 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FSS +FDYSWEEVSTANW+KY PWN+KSTHVIAVDT+ RHVD +GILRTE Sbjct: 1 MKVFSSDCKFDYSWEEVSTANWRKYCPWNEKSTHVIAVDTLSRHVDAETGILRTE 55 >ref|XP_001267426.1| mitochondrial protein sorting (Msf1), putative [Neosartorya fischeri NRRL 181] gi|119415591|gb|EAW25529.1| mitochondrial protein sorting (Msf1), putative [Neosartorya fischeri NRRL 181] Length = 190 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/55 (80%), Positives = 48/55 (87%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FSS FDYSWEEVSTANW+KY PWNDKSTHV+AVDTI R VDP +GILRTE Sbjct: 1 MKVFSSTCTFDYSWEEVSTANWRKYCPWNDKSTHVVAVDTISRTVDPKTGILRTE 55 >gb|EXJ85060.1| hypothetical protein A1O3_05735 [Capronia epimyces CBS 606.96] Length = 192 Score = 97.4 bits (241), Expect = 2e-18 Identities = 41/55 (74%), Positives = 49/55 (89%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 M+IFSS + FDYSWEEVST NW+KY PWNDK++HV+AVDT+ RHVDP +GILRTE Sbjct: 1 MRIFSSSYTFDYSWEEVSTNNWRKYCPWNDKASHVLAVDTLSRHVDPETGILRTE 55 >gb|ESZ97409.1| protein MSF1 [Sclerotinia borealis F-4157] Length = 188 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FSS +FDYSWEEVSTANW+KY PWNDKSTHVIAVDT+ R+VD +GILRTE Sbjct: 1 MKVFSSDCKFDYSWEEVSTANWRKYCPWNDKSTHVIAVDTLSRYVDAETGILRTE 55 >gb|EFX04358.1| mitochondrial protein sorting [Grosmannia clavigera kw1407] Length = 230 Score = 97.1 bits (240), Expect = 2e-18 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FS+ FDYSWEEVSTANW+KY PWNDKSTHVIAVDT+ R VDP +G+LRTE Sbjct: 1 MKVFSNSVTFDYSWEEVSTANWRKYCPWNDKSTHVIAVDTLSRSVDPETGVLRTE 55 >ref|XP_001554449.1| hypothetical protein BC1G_07037 [Botryotinia fuckeliana B05.10] gi|347836593|emb|CCD51165.1| similar to protein MSF1 [Botryotinia fuckeliana T4] gi|472244636|gb|EMR89245.1| putative protein msf1 protein [Botryotinia fuckeliana BcDW1] Length = 189 Score = 97.1 bits (240), Expect = 2e-18 Identities = 43/55 (78%), Positives = 48/55 (87%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FSS +FDYSWEEVSTANW+KY PWN KSTHVIAVDT+ RHVD +GILRTE Sbjct: 1 MKVFSSDCKFDYSWEEVSTANWRKYCPWNHKSTHVIAVDTLSRHVDADTGILRTE 55 >gb|EKV05289.1| Mitochondrial protein sorting (Msf1), putative [Penicillium digitatum PHI26] gi|425781901|gb|EKV19837.1| Mitochondrial protein sorting (Msf1), putative [Penicillium digitatum Pd1] Length = 190 Score = 96.7 bits (239), Expect = 3e-18 Identities = 41/55 (74%), Positives = 49/55 (89%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FSS+ FDYSW+EVSTANW+KY PWNDKSTHV+ VDT+ R VDP++GILRTE Sbjct: 1 MKVFSSECTFDYSWDEVSTANWRKYCPWNDKSTHVVGVDTLSRTVDPSTGILRTE 55 >ref|XP_001271481.1| mitochondrial protein sorting (Msf1), putative [Aspergillus clavatus NRRL 1] gi|119399629|gb|EAW10055.1| mitochondrial protein sorting (Msf1), putative [Aspergillus clavatus NRRL 1] Length = 190 Score = 96.7 bits (239), Expect = 3e-18 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FSS FDYSWEEV+TANW+KY PWNDKSTHV+AVDT+ R VDP +GILRTE Sbjct: 1 MKVFSSTCTFDYSWEEVTTANWRKYCPWNDKSTHVVAVDTLSRSVDPMTGILRTE 55 >gb|ETS80995.1| hypothetical protein PFICI_05997 [Pestalotiopsis fici W106-1] Length = 183 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/55 (78%), Positives = 48/55 (87%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FS+ F+YSWEEVSTANWQKY PWNDKS HVIAVDTI R+VD T+GILRTE Sbjct: 1 MKVFSNSVTFNYSWEEVSTANWQKYGPWNDKSAHVIAVDTISRNVDATTGILRTE 55 >gb|EGY19825.1| MSF1 protein [Verticillium dahliae VdLs.17] Length = 192 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/55 (78%), Positives = 47/55 (85%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FS+ F+YSWEEVSTANW KY PWNDKSTHVIAVDT+ R VDP SGILRTE Sbjct: 1 MKVFSNSVTFNYSWEEVSTANWNKYCPWNDKSTHVIAVDTLARRVDPESGILRTE 55 >ref|XP_003007521.1| MSF1 [Verticillium alfalfae VaMs.102] gi|261353172|gb|EEY15600.1| MSF1 [Verticillium alfalfae VaMs.102] Length = 192 Score = 96.3 bits (238), Expect = 4e-18 Identities = 43/55 (78%), Positives = 47/55 (85%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FS+ F+YSWEEVSTANW KY PWNDKSTHVIAVDT+ R VDP SGILRTE Sbjct: 1 MKVFSNSVTFNYSWEEVSTANWNKYCPWNDKSTHVIAVDTLARRVDPESGILRTE 55 >gb|EKG21567.1| PRELI/MSF1 domain-containing protein [Macrophomina phaseolina MS6] Length = 191 Score = 95.9 bits (237), Expect = 5e-18 Identities = 41/55 (74%), Positives = 48/55 (87%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MKIFS+ HEF+YSWEEVS NW+KY PWN+K+ HVIAVDT+ RHVDP +GILRTE Sbjct: 1 MKIFSTTHEFNYSWEEVSINNWRKYCPWNEKTPHVIAVDTLARHVDPATGILRTE 55 >ref|XP_001911789.1| hypothetical protein [Podospora anserina S mat+] gi|170946813|emb|CAP73617.1| unnamed protein product [Podospora anserina S mat+] Length = 198 Score = 95.9 bits (237), Expect = 5e-18 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FS+ F+YSWEEVSTANW+KY PWNDKSTHV+AVDTI R VDP +GILRTE Sbjct: 1 MKVFSNTETFNYSWEEVSTANWRKYCPWNDKSTHVLAVDTISRTVDPETGILRTE 55 >gb|ERT02957.1| hypothetical protein HMPREF1624_01261 [Sporothrix schenckii ATCC 58251] Length = 219 Score = 95.5 bits (236), Expect = 7e-18 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = +1 Query: 199 MKIFSSQHEFDYSWEEVSTANWQKYSPWNDKSTHVIAVDTIQRHVDPTSGILRTE 363 MK+FS+ FDYSWEEVSTANW+KY PWN+KSTHVIAVDT+ R VDP +GILRTE Sbjct: 1 MKVFSNTCTFDYSWEEVSTANWRKYCPWNEKSTHVIAVDTLSRTVDPATGILRTE 55