BLASTX nr result
ID: Akebia23_contig00053428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00053428 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007761644.1| reverse transcriptase [Rose yellow vein viru... 69 9e-10 >ref|YP_007761644.1| reverse transcriptase [Rose yellow vein virus] gi|397559412|gb|AFO54491.1| reverse transcriptase [Rose yellow vein virus] Length = 819 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/74 (45%), Positives = 51/74 (68%) Frame = -3 Query: 375 LEIFRIFLMSDKFILQTDSIAVRGFLSNKDIDTKTLAKQIRDKLRVLTYHDWMQIEHIPG 196 L+ F++FL + F L +D++AV FL KD++ K ++IRDKL +L Y WM ++HIPG Sbjct: 747 LQKFKLFLF-EPFTLYSDNLAVINFLK-KDLNEKRSQREIRDKLDILQYQGWMTLKHIPG 804 Query: 195 AKNFITDSLTRALA 154 KN + D+LTR L+ Sbjct: 805 TKNVLADALTRGLS 818