BLASTX nr result
ID: Akebia23_contig00050105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00050105 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516723.1| cytochrome P450, putative [Ricinus communis]... 39 6e-06 >ref|XP_002516723.1| cytochrome P450, putative [Ricinus communis] gi|223544096|gb|EEF45621.1| cytochrome P450, putative [Ricinus communis] Length = 515 Score = 39.3 bits (90), Expect(2) = 6e-06 Identities = 24/44 (54%), Positives = 27/44 (61%) Frame = +3 Query: 96 RLLLLEQTSTSIVGKLFIY*NGSRS*MCLTEMELIRELLSYLST 227 RLL T + GK FIY NG MCLTE ELI+ELL+ ST Sbjct: 79 RLLPHFVTWSKQYGKRFIYWNGIEPRMCLTETELIKELLTKYST 122 Score = 36.2 bits (82), Expect(2) = 6e-06 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +2 Query: 212 LISKYSNLSGKSWLQQQGSK 271 L++KYS +GKSWLQQQGSK Sbjct: 116 LLTKYSTKAGKSWLQQQGSK 135