BLASTX nr result
ID: Akebia23_contig00050032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00050032 (233 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524777.1| ATP binding protein, putative [Ricinus commu... 50 1e-06 ref|XP_007199072.1| hypothetical protein PRUPE_ppa018798mg [Prun... 45 4e-06 ref|XP_006845817.1| hypothetical protein AMTR_s00019p00257180 [A... 51 5e-06 ref|XP_002314438.2| hypothetical protein POPTR_0010s02810g, part... 49 8e-06 >ref|XP_002524777.1| ATP binding protein, putative [Ricinus communis] gi|223535961|gb|EEF37620.1| ATP binding protein, putative [Ricinus communis] Length = 462 Score = 50.4 bits (119), Expect(2) = 1e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -2 Query: 142 IRLLHESCPKQIIHRDIKASNILLTEELEP 53 IR LHE C ++IIHRDIKA+NILLTE+ EP Sbjct: 259 IRYLHEDCQRRIIHRDIKAANILLTEDFEP 288 Score = 27.7 bits (60), Expect(2) = 1e-06 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 173 SKETLDWGIRYKVA 132 SKETL W IRYK+A Sbjct: 239 SKETLKWDIRYKIA 252 >ref|XP_007199072.1| hypothetical protein PRUPE_ppa018798mg [Prunus persica] gi|462394472|gb|EMJ00271.1| hypothetical protein PRUPE_ppa018798mg [Prunus persica] Length = 422 Score = 45.4 bits (106), Expect(2) = 4e-06 Identities = 19/29 (65%), Positives = 25/29 (86%) Frame = -2 Query: 142 IRLLHESCPKQIIHRDIKASNILLTEELE 56 ++ LHE C ++IIHRDIKA+NILLTE+ E Sbjct: 225 LQYLHEGCQRRIIHRDIKAANILLTEDFE 253 Score = 30.8 bits (68), Expect(2) = 4e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 173 SKETLDWGIRYKVA 132 SKE LDWGIRYK+A Sbjct: 205 SKEKLDWGIRYKIA 218 >ref|XP_006845817.1| hypothetical protein AMTR_s00019p00257180 [Amborella trichopoda] gi|548848389|gb|ERN07492.1| hypothetical protein AMTR_s00019p00257180 [Amborella trichopoda] Length = 507 Score = 51.2 bits (121), Expect(2) = 5e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -2 Query: 142 IRLLHESCPKQIIHRDIKASNILLTEELEP 53 ++ LH+ CP++IIHRDIKASNILLTE+ EP Sbjct: 301 LQYLHDGCPRRIIHRDIKASNILLTEDFEP 330 Score = 24.6 bits (52), Expect(2) = 5e-06 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 173 SKETLDWGIRYKVA 132 SK+ DW +RYKVA Sbjct: 281 SKQKPDWAVRYKVA 294 >ref|XP_002314438.2| hypothetical protein POPTR_0010s02810g, partial [Populus trichocarpa] gi|550328970|gb|EEF00609.2| hypothetical protein POPTR_0010s02810g, partial [Populus trichocarpa] Length = 472 Score = 48.9 bits (115), Expect(2) = 8e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = -2 Query: 133 LHESCPKQIIHRDIKASNILLTEELEP 53 LHE C ++IIH+DIKASNILLTE+LEP Sbjct: 267 LHEECQRRIIHKDIKASNILLTEDLEP 293 Score = 26.2 bits (56), Expect(2) = 8e-06 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 170 KETLDWGIRYKVA 132 KE LDW IRYK+A Sbjct: 245 KEKLDWRIRYKIA 257