BLASTX nr result
ID: Akebia23_contig00048341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00048341 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXJ89951.1| large subunit ribosomal protein L18e [Capronia ep... 84 2e-14 gb|EON63767.1| 60S ribosomal protein L18-B [Coniosporium apollin... 82 6e-14 gb|EXJ94695.1| large subunit ribosomal protein L18e [Capronia co... 81 1e-13 gb|EXJ73523.1| large subunit ribosomal protein L18e [Cladophialo... 81 2e-13 gb|EMC95692.1| hypothetical protein BAUCODRAFT_122987 [Baudoinia... 81 2e-13 ref|XP_390042.1| hypothetical protein FG09866.1 [Fusarium gramin... 80 2e-13 gb|EWG39972.1| 50S ribosomal protein L18e [Fusarium verticillioi... 80 3e-13 gb|ERF69746.1| hypothetical protein EPUS_07572 [Endocarpon pusil... 80 3e-13 emb|CCT68782.1| probable ribosomal protein L18, cytosolic [Fusar... 80 3e-13 ref|XP_007586342.1| putative 60s ribosomal protein l18 protein [... 80 3e-13 gb|EKG21215.1| Ribosomal protein L18e [Macrophomina phaseolina MS6] 80 3e-13 gb|EGU80235.1| hypothetical protein FOXB_09162 [Fusarium oxyspor... 80 3e-13 emb|CCU77907.1| putative 60S ribosomal protein L18 [Blumeria gra... 80 4e-13 gb|EPQ63217.1| Protein component of the large (60S) ribosomal su... 80 4e-13 gb|EMR82472.1| putative 60s ribosomal protein l18 protein [Botry... 80 4e-13 emb|CCF40156.1| eukaryotic ribosomal protein L18 [Colletotrichum... 80 4e-13 gb|EHY58512.1| 50S ribosomal protein L18e [Exophiala dermatitidi... 80 4e-13 gb|EFQ34059.1| eukaryotic ribosomal protein L18 [Colletotrichum ... 80 4e-13 ref|XP_001550924.1| 60S ribosomal protein L18 [Botryotinia fucke... 80 4e-13 ref|XP_001209532.1| 60S ribosomal protein L18 [Aspergillus terre... 79 5e-13 >gb|EXJ89951.1| large subunit ribosomal protein L18e [Capronia epimyces CBS 606.96] Length = 162 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPHSHKKPKVESKGRKFE+ARGRRRSKGFKV Sbjct: 124 EAVKHFGFGPHSHKKPKVESKGRKFERARGRRRSKGFKV 162 >gb|EON63767.1| 60S ribosomal protein L18-B [Coniosporium apollinis CBS 100218] Length = 189 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPHSHKKP VESKGRKFEKARGRRRSKGFKV Sbjct: 151 EAVKHFGFGPHSHKKPYVESKGRKFEKARGRRRSKGFKV 189 >gb|EXJ94695.1| large subunit ribosomal protein L18e [Capronia coronata CBS 617.96] Length = 189 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPHSHKKP VESKGRKFE+ARGRRRSKGFKV Sbjct: 151 EAVKHFGFGPHSHKKPYVESKGRKFERARGRRRSKGFKV 189 >gb|EXJ73523.1| large subunit ribosomal protein L18e [Cladophialophora psammophila CBS 110553] Length = 191 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPH HKKP VESKGRKFEKARGRRRSKGFKV Sbjct: 153 EAVKHFGFGPHKHKKPYVESKGRKFEKARGRRRSKGFKV 191 >gb|EMC95692.1| hypothetical protein BAUCODRAFT_122987 [Baudoinia compniacensis UAMH 10762] Length = 189 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPHSHKKP VESKGRKFEK RGRRRSKGFKV Sbjct: 151 EAVKHFGFGPHSHKKPYVESKGRKFEKGRGRRRSKGFKV 189 >ref|XP_390042.1| hypothetical protein FG09866.1 [Fusarium graminearum PH-1] gi|558866423|gb|ESU16506.1| hypothetical protein FGSG_09866 [Fusarium graminearum PH-1] gi|596541613|gb|EYB22199.1| hypothetical protein FG05_09866 [Fusarium graminearum] Length = 184 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPHSHKKP VESKGRKFE+ARGRRRS+GFKV Sbjct: 146 EAVKHFGFGPHSHKKPHVESKGRKFERARGRRRSRGFKV 184 >gb|EWG39972.1| 50S ribosomal protein L18e [Fusarium verticillioides 7600] Length = 184 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPHSHKKP VESKGRKFE+ARGRRRS+GFKV Sbjct: 146 EAVKHFGFGPHSHKKPYVESKGRKFERARGRRRSRGFKV 184 >gb|ERF69746.1| hypothetical protein EPUS_07572 [Endocarpon pusillum Z07020] Length = 517 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPHSHKKP V+SKGRKFEKARGRRRS+GFKV Sbjct: 479 EAVKHFGFGPHSHKKPYVQSKGRKFEKARGRRRSRGFKV 517 >emb|CCT68782.1| probable ribosomal protein L18, cytosolic [Fusarium fujikuroi IMI 58289] Length = 230 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPHSHKKP VESKGRKFE+ARGRRRS+GFKV Sbjct: 192 EAVKHFGFGPHSHKKPYVESKGRKFERARGRRRSRGFKV 230 >ref|XP_007586342.1| putative 60s ribosomal protein l18 protein [Neofusicoccum parvum UCRNP2] gi|485920050|gb|EOD46179.1| putative 60s ribosomal protein l18 protein [Neofusicoccum parvum UCRNP2] Length = 189 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPHSHKKP VESKGRKFE+ARGRRRS+GFKV Sbjct: 151 EAVKHFGFGPHSHKKPYVESKGRKFERARGRRRSRGFKV 189 >gb|EKG21215.1| Ribosomal protein L18e [Macrophomina phaseolina MS6] Length = 189 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPHSHKKP VESKGRKFE+ARGRRRS+GFKV Sbjct: 151 EAVKHFGFGPHSHKKPYVESKGRKFERARGRRRSRGFKV 189 >gb|EGU80235.1| hypothetical protein FOXB_09162 [Fusarium oxysporum Fo5176] gi|475665996|gb|EMT63788.1| 60S ribosomal protein L18-B [Fusarium oxysporum f. sp. cubense race 4] gi|477509475|gb|ENH62767.1| 60S ribosomal protein L18-B [Fusarium oxysporum f. sp. cubense race 1] gi|587668881|gb|EWY91222.1| 50S ribosomal protein L18e [Fusarium oxysporum FOSC 3-a] gi|587691224|gb|EWZ37829.1| 50S ribosomal protein L18e [Fusarium oxysporum Fo47] gi|587718172|gb|EWZ89509.1| 50S ribosomal protein L18e [Fusarium oxysporum f. sp. lycopersici MN25] gi|587747715|gb|EXA45431.1| 50S ribosomal protein L18e [Fusarium oxysporum f. sp. pisi HDV247] gi|590038027|gb|EXK39885.1| 50S ribosomal protein L18e [Fusarium oxysporum f. sp. melonis 26406] gi|590063855|gb|EXK91379.1| 50S ribosomal protein L18e [Fusarium oxysporum f. sp. raphani 54005] gi|591422163|gb|EXL57300.1| 50S ribosomal protein L18e [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591452145|gb|EXL84448.1| 50S ribosomal protein L18e [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591469916|gb|EXM01220.1| 50S ribosomal protein L18e [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591502895|gb|EXM32240.1| 50S ribosomal protein L18e [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 184 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPHSHKKP VESKGRKFE+ARGRRRS+GFKV Sbjct: 146 EAVKHFGFGPHSHKKPYVESKGRKFERARGRRRSRGFKV 184 >emb|CCU77907.1| putative 60S ribosomal protein L18 [Blumeria graminis f. sp. hordei DH14] Length = 184 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPH HKKP VESKGRKFEKARGRRRS+GFKV Sbjct: 146 EAVKHFGFGPHKHKKPYVESKGRKFEKARGRRRSRGFKV 184 >gb|EPQ63217.1| Protein component of the large (60S) ribosomal subunit [Blumeria graminis f. sp. tritici 96224] Length = 132 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPH HKKP VESKGRKFEKARGRRRS+GFKV Sbjct: 94 EAVKHFGFGPHKHKKPYVESKGRKFEKARGRRRSRGFKV 132 >gb|EMR82472.1| putative 60s ribosomal protein l18 protein [Botryotinia fuckeliana BcDW1] Length = 205 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPH HKKP VESKGRKFEKARGRRRS+GFKV Sbjct: 167 EAVKHFGFGPHKHKKPYVESKGRKFEKARGRRRSRGFKV 205 >emb|CCF40156.1| eukaryotic ribosomal protein L18 [Colletotrichum higginsianum] Length = 183 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPH HKKP VESKGRKFEKARGRRRS+GFKV Sbjct: 145 EAVKHFGFGPHKHKKPYVESKGRKFEKARGRRRSRGFKV 183 >gb|EHY58512.1| 50S ribosomal protein L18e [Exophiala dermatitidis NIH/UT8656] Length = 189 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPH HKKP VESKGRKFE+ARGRRRSKGFKV Sbjct: 151 EAVKHFGFGPHKHKKPYVESKGRKFERARGRRRSKGFKV 189 >gb|EFQ34059.1| eukaryotic ribosomal protein L18 [Colletotrichum graminicola M1.001] Length = 183 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPH HKKP VESKGRKFEKARGRRRS+GFKV Sbjct: 145 EAVKHFGFGPHKHKKPYVESKGRKFEKARGRRRSRGFKV 183 >ref|XP_001550924.1| 60S ribosomal protein L18 [Botryotinia fuckeliana B05.10] gi|347831134|emb|CCD46831.1| similar to 60S ribosomal protein L18 [Botryotinia fuckeliana T4] Length = 183 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPH HKKP VESKGRKFEKARGRRRS+GFKV Sbjct: 145 EAVKHFGFGPHKHKKPYVESKGRKFEKARGRRRSRGFKV 183 >ref|XP_001209532.1| 60S ribosomal protein L18 [Aspergillus terreus NIH2624] gi|114190531|gb|EAU32231.1| 60S ribosomal protein L18 [Aspergillus terreus NIH2624] Length = 184 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 243 EAVKHFGFGPHSHKKPKVESKGRKFEKARGRRRSKGFKV 127 EAVKHFGFGPHSHKKP V SKGRKFE+ARGRRRSKGFKV Sbjct: 146 EAVKHFGFGPHSHKKPYVRSKGRKFERARGRRRSKGFKV 184