BLASTX nr result
ID: Akebia23_contig00048252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00048252 (558 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67410.1| hypothetical protein VITISV_025621 [Vitis vinifera] 72 7e-11 >emb|CAN67410.1| hypothetical protein VITISV_025621 [Vitis vinifera] Length = 735 Score = 72.4 bits (176), Expect = 7e-11 Identities = 47/114 (41%), Positives = 66/114 (57%), Gaps = 14/114 (12%) Frame = -2 Query: 302 SLTMSSDAVTSYLIRRNSMVSSTIPSEHNIPLKKHRSSIL------------LTNGDKAS 159 S ++S +S L RRNS+ ++ IP++ +P K H SS ++ ++S Sbjct: 556 SASISHPPPSSNLRRRNSIGTAAIPTKLTLPSKAHYSSSFPRPNGVRVSSSTSSSSPQSS 615 Query: 158 FPTFDLELFSLKSPSYTSLKDLPPASPLHQSPSEIGI--QSIYEIPIKNQLVKQ 3 FP D EL SLKS +YTSLKDL P++ QSP+ G S YEI I+N+LVKQ Sbjct: 616 FPNVDFELISLKSLAYTSLKDLLPSTSAAQSPTAAGTGSGSCYEISIRNRLVKQ 669