BLASTX nr result
ID: Akebia23_contig00047799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00047799 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001806136.1| hypothetical protein SNOG_16005 [Phaeosphaer... 56 5e-06 >ref|XP_001806136.1| hypothetical protein SNOG_16005 [Phaeosphaeria nodorum SN15] gi|111055464|gb|EAT76584.1| hypothetical protein SNOG_16005 [Phaeosphaeria nodorum SN15] Length = 41 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/41 (60%), Positives = 28/41 (68%) Frame = +3 Query: 105 MGLMWTKHFXXXXXXXXXXXDKNGVRRAPFRISCGRFSCFR 227 MGLMW K F D++GVRRAPFR+SCGRFSCFR Sbjct: 1 MGLMWHKGFGGRHAGGGVVADRHGVRRAPFRLSCGRFSCFR 41