BLASTX nr result
ID: Akebia23_contig00047471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00047471 (512 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21799.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_002269180.1| PREDICTED: protein methyltransferase hemK ho... 61 2e-07 ref|XP_006394193.1| hypothetical protein EUTSA_v10004403mg [Eutr... 58 1e-06 ref|XP_006846007.1| hypothetical protein AMTR_s00155p00066160 [A... 55 8e-06 >emb|CBI21799.3| unnamed protein product [Vitis vinifera] Length = 254 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -1 Query: 512 ETNGGKQSKFLEDFMINRSKNSFRDVKIVSDFAGIPRFIAGF 387 ETNG KQ KFL D+M N SK +F DVKIV DFAGI RF+ GF Sbjct: 211 ETNGEKQCKFLVDYMENESKGNFYDVKIVPDFAGIQRFVTGF 252 >ref|XP_002269180.1| PREDICTED: protein methyltransferase hemK homolog [Vitis vinifera] Length = 356 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -1 Query: 512 ETNGGKQSKFLEDFMINRSKNSFRDVKIVSDFAGIPRFIAGF 387 ETNG KQ KFL D+M N SK +F DVKIV DFAGI RF+ GF Sbjct: 313 ETNGEKQCKFLVDYMENESKGNFYDVKIVPDFAGIQRFVTGF 354 >ref|XP_006394193.1| hypothetical protein EUTSA_v10004403mg [Eutrema salsugineum] gi|557090832|gb|ESQ31479.1| hypothetical protein EUTSA_v10004403mg [Eutrema salsugineum] Length = 379 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -1 Query: 512 ETNGGKQSKFLEDFMINRSKNSFRDVKIVSDFAGIPRFIAGF 387 ETNG KQSK + D+M N K++F D++IVSDFAGI RF++GF Sbjct: 336 ETNGEKQSKMIVDYMTNDLKDTFSDLRIVSDFAGIDRFVSGF 377 >ref|XP_006846007.1| hypothetical protein AMTR_s00155p00066160 [Amborella trichopoda] gi|548848763|gb|ERN07682.1| hypothetical protein AMTR_s00155p00066160 [Amborella trichopoda] Length = 263 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -1 Query: 512 ETNGGKQSKFLEDFMINRSKNSFRDVKIVSDFAGIPRFIAGF 387 ETNG QSK + +F+ KN F DVKI SDFAGIPRF+ GF Sbjct: 220 ETNGKDQSKIIAEFLHTMPKNGFCDVKIRSDFAGIPRFVTGF 261