BLASTX nr result
ID: Akebia23_contig00047449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00047449 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007150302.1| hypothetical protein PHAVU_005G142000g [Phas... 76 4e-12 ref|XP_006653972.1| PREDICTED: probable histone H2A.6-like [Oryz... 76 6e-12 gb|AFK46765.1| unknown [Lotus japonicus] 76 6e-12 gb|AFK41325.1| unknown [Lotus japonicus] 76 6e-12 ref|XP_006344647.1| PREDICTED: histone H2A.1-like [Solanum tuber... 75 7e-12 ref|XP_004230227.1| PREDICTED: histone H2A.1-like [Solanum lycop... 75 7e-12 dbj|BAL49713.1| fusion protein of histone 2A and enhanced yellow... 75 7e-12 gb|EYU41689.1| hypothetical protein MIMGU_mgv1a015617mg [Mimulus... 75 1e-11 sp|P02276.1|H2A2_WHEAT RecName: Full=Histone H2A.2.1 75 1e-11 ref|NP_001043136.1| Os01g0502700 [Oryza sativa Japonica Group] g... 75 1e-11 sp|P02277.1|H2A3_WHEAT RecName: Full=Histone H2A.2.2 75 1e-11 ref|XP_006649862.1| PREDICTED: probable histone H2A.5-like [Oryz... 75 1e-11 ref|XP_004294587.1| PREDICTED: histone H2A-like [Fragaria vesca ... 75 1e-11 gb|AAB00193.1| histone H2A [Triticum aestivum] gi|1325968|emb|CA... 75 1e-11 gb|EXC35050.1| putative histone H2A.4 [Morus notabilis] 75 1e-11 sp|Q43213.3|H2A5_WHEAT RecName: Full=Protein H2A.5; AltName: Ful... 75 1e-11 sp|P02275.2|H2A1_WHEAT RecName: Full=Histone H2A.1; AltName: Ful... 75 1e-11 gb|EPS64904.1| hypothetical protein M569_09875, partial [Genlise... 75 1e-11 ref|XP_004984759.1| PREDICTED: histone H2A-like [Setaria italica] 75 1e-11 ref|XP_004970473.1| PREDICTED: histone H2A-like [Setaria italica] 75 1e-11 >ref|XP_007150302.1| hypothetical protein PHAVU_005G142000g [Phaseolus vulgaris] gi|561023566|gb|ESW22296.1| hypothetical protein PHAVU_005G142000g [Phaseolus vulgaris] Length = 149 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -1 Query: 240 VSWFIKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 VS +KA LQFPVGRIGRYLKKGRY QR+GS APIYL A+LEYL A+V Sbjct: 24 VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAAVLEYLAAEV 71 >ref|XP_006653972.1| PREDICTED: probable histone H2A.6-like [Oryza brachyantha] Length = 154 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -1 Query: 240 VSWFIKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 VS +KA LQFPVGRIGRYLKKGRY QR+GS AP+YL A+LEYL A+V Sbjct: 26 VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEV 73 >gb|AFK46765.1| unknown [Lotus japonicus] Length = 155 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -1 Query: 240 VSWFIKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 VS +KA LQFPVGRIGRYLKKGRY QR+GS AP+YL A+LEYL A+V Sbjct: 26 VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEV 73 >gb|AFK41325.1| unknown [Lotus japonicus] Length = 155 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -1 Query: 240 VSWFIKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 VS +KA LQFPVGRIGRYLKKGRY QR+GS AP+YL A+LEYL A+V Sbjct: 26 VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEV 73 >ref|XP_006344647.1| PREDICTED: histone H2A.1-like [Solanum tuberosum] Length = 146 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -1 Query: 228 IKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 IKA LQFPVGRIGRYLKKGRY QR+GS APIYL A+LEYL A+V Sbjct: 26 IKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAAVLEYLAAEV 69 >ref|XP_004230227.1| PREDICTED: histone H2A.1-like [Solanum lycopersicum] gi|122003|sp|P25469.1|H2A1_SOLLC RecName: Full=Histone H2A.1; AltName: Full=LeH2A-1 gi|355477218|gb|AES12482.1| putative histone 2A protein [Solanum lycopersicum] Length = 146 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -1 Query: 228 IKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 IKA LQFPVGRIGRYLKKGRY QR+GS APIYL A+LEYL A+V Sbjct: 26 IKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAAVLEYLAAEV 69 >dbj|BAL49713.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00001] gi|374428674|dbj|BAL49716.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00002] gi|374428678|dbj|BAL49719.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00003] gi|374428682|dbj|BAL49722.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00004] gi|374428686|dbj|BAL49725.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00005] gi|374428690|dbj|BAL49728.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00006] gi|374428694|dbj|BAL49731.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00007] gi|374428698|dbj|BAL49734.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00008] gi|374428702|dbj|BAL49737.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00009] gi|374428706|dbj|BAL49740.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00010] gi|374428710|dbj|BAL49743.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00011] gi|374428714|dbj|BAL49746.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00012] gi|374428718|dbj|BAL49749.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00013] gi|374428722|dbj|BAL49752.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00014] gi|374428726|dbj|BAL49755.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00015] gi|374428730|dbj|BAL49758.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00016] gi|374428734|dbj|BAL49761.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00017] gi|374428738|dbj|BAL49764.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00018] gi|374428742|dbj|BAL49767.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00019] gi|374428748|dbj|BAL49770.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00020] gi|374428752|dbj|BAL49773.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00021] gi|374428756|dbj|BAL49776.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00022] gi|374428760|dbj|BAL49779.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00023] gi|374428764|dbj|BAL49782.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00024] gi|374428768|dbj|BAL49785.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00025] gi|374428772|dbj|BAL49788.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00026] gi|374428776|dbj|BAL49791.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00027] gi|374428780|dbj|BAL49794.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00028] gi|374428784|dbj|BAL49797.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00029] gi|374428788|dbj|BAL49800.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00030] gi|374428792|dbj|BAL49803.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00031] gi|374428796|dbj|BAL49806.1| fusion protein of histone 2A and enhanced yellow fluorescence protein [Cloning vector pSolycp00032] Length = 387 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -1 Query: 228 IKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 IKA LQFPVGRIGRYLKKGRY QR+GS APIYL A+LEYL A+V Sbjct: 26 IKAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAAVLEYLAAEV 69 >gb|EYU41689.1| hypothetical protein MIMGU_mgv1a015617mg [Mimulus guttatus] Length = 151 Score = 75.1 bits (183), Expect = 1e-11 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = -1 Query: 240 VSWFIKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 VS +KA LQFPVGRIGRYLKKGRY QR+GS APIY+ A+LEYL A+V Sbjct: 24 VSRSVKAGLQFPVGRIGRYLKKGRYSQRVGSGAPIYMAAVLEYLAAEV 71 >sp|P02276.1|H2A2_WHEAT RecName: Full=Histone H2A.2.1 Length = 151 Score = 75.1 bits (183), Expect = 1e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 228 IKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 IKA LQFPVGRIGRYLKKGRY QR+GS AP+YL A+LEYL A+V Sbjct: 26 IKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEV 69 >ref|NP_001043136.1| Os01g0502700 [Oryza sativa Japonica Group] gi|115452261|ref|NP_001049731.1| Os03g0279200 [Oryza sativa Japonica Group] gi|75306404|sp|Q94E96.1|H2A5_ORYSJ RecName: Full=Probable histone H2A.5 gi|158512828|sp|A2WQG7.1|H2A5_ORYSI RecName: Full=Probable histone H2A.5 gi|13873032|dbj|BAB44136.1| putative histone H2A [Oryza sativa Japonica Group] gi|108707496|gb|ABF95291.1| Histone H2A, putative, expressed [Oryza sativa Japonica Group] gi|113532667|dbj|BAF05050.1| Os01g0502700 [Oryza sativa Japonica Group] gi|113548202|dbj|BAF11645.1| Os03g0279200 [Oryza sativa Japonica Group] gi|125526099|gb|EAY74213.1| hypothetical protein OsI_02094 [Oryza sativa Indica Group] gi|125543339|gb|EAY89478.1| hypothetical protein OsI_11008 [Oryza sativa Indica Group] gi|125570532|gb|EAZ12047.1| hypothetical protein OsJ_01928 [Oryza sativa Japonica Group] gi|125585800|gb|EAZ26464.1| hypothetical protein OsJ_10353 [Oryza sativa Japonica Group] gi|215768407|dbj|BAH00636.1| unnamed protein product [Oryza sativa Japonica Group] Length = 159 Score = 75.1 bits (183), Expect = 1e-11 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -1 Query: 240 VSWFIKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 VS +KA LQFPVGRIGRYLKKGRY QR+G+ AP+YL A+LEYL A+V Sbjct: 29 VSRSVKAGLQFPVGRIGRYLKKGRYAQRIGTGAPVYLAAVLEYLAAEV 76 >sp|P02277.1|H2A3_WHEAT RecName: Full=Histone H2A.2.2 Length = 151 Score = 75.1 bits (183), Expect = 1e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 228 IKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 IKA LQFPVGRIGRYLKKGRY QR+GS AP+YL A+LEYL A+V Sbjct: 26 IKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEV 69 >ref|XP_006649862.1| PREDICTED: probable histone H2A.5-like [Oryza brachyantha] Length = 159 Score = 75.1 bits (183), Expect = 1e-11 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -1 Query: 240 VSWFIKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 VS +KA LQFPVGRIGRYLKKGRY QR+G+ AP+YL A+LEYL A+V Sbjct: 29 VSRSVKAGLQFPVGRIGRYLKKGRYAQRIGTGAPVYLAAVLEYLAAEV 76 >ref|XP_004294587.1| PREDICTED: histone H2A-like [Fragaria vesca subsp. vesca] Length = 156 Score = 75.1 bits (183), Expect = 1e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -1 Query: 228 IKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 IKA LQFPVGRIGRYLKKGRY QR+GS AP+YL A+LEYL A+V Sbjct: 29 IKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEV 72 >gb|AAB00193.1| histone H2A [Triticum aestivum] gi|1325968|emb|CAA64423.1| histone H2A [Triticum aestivum] Length = 146 Score = 75.1 bits (183), Expect = 1e-11 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 228 IKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 +KA LQFPVGRIGRYLKKGRY QR+GS AP+YL A+LEYL A+V Sbjct: 17 VKAGLQFPVGRIGRYLKKGRYAQRIGSGAPVYLAAVLEYLAAEV 60 >gb|EXC35050.1| putative histone H2A.4 [Morus notabilis] Length = 149 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -1 Query: 240 VSWFIKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 VS +KA LQFPVGRIGRYLKKGRY QR+G+ AP+YL A+LEYL A+V Sbjct: 24 VSRSVKAGLQFPVGRIGRYLKKGRYSQRIGTGAPVYLAAVLEYLAAEV 71 >sp|Q43213.3|H2A5_WHEAT RecName: Full=Protein H2A.5; AltName: Full=wcH2A-2 gi|536888|dbj|BAA07276.1| protein H2A [Triticum aestivum] gi|1095224|prf||2108279A histone H2A:ISOTYPE=2 Length = 145 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 228 IKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 +KA LQFPVGRIGRYLKKGRY QR+GS AP+YL A+LEYL A+V Sbjct: 17 VKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEV 60 >sp|P02275.2|H2A1_WHEAT RecName: Full=Histone H2A.1; AltName: Full=wcH2A-9 gi|536894|dbj|BAA07279.1| protein H2A [Triticum aestivum] gi|1095225|prf||2108279B histone H2A:ISOTYPE=9 Length = 146 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 228 IKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 +KA LQFPVGRIGRYLKKGRY QR+GS AP+YL A+LEYL A+V Sbjct: 17 VKAGLQFPVGRIGRYLKKGRYAQRVGSGAPVYLAAVLEYLAAEV 60 >gb|EPS64904.1| hypothetical protein M569_09875, partial [Genlisea aurea] Length = 147 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -1 Query: 240 VSWFIKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 +S ++A LQFPVGRIGRYLKKGRY QR+GS APIYL A+LEYL A+V Sbjct: 27 ISRSVRAGLQFPVGRIGRYLKKGRYAQRVGSGAPIYLAAVLEYLAAEV 74 >ref|XP_004984759.1| PREDICTED: histone H2A-like [Setaria italica] Length = 159 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -1 Query: 240 VSWFIKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 VS +KA LQFPVGRIGRYLKKGRY QR+G+ AP+YL A+LEYL A+V Sbjct: 29 VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEV 76 >ref|XP_004970473.1| PREDICTED: histone H2A-like [Setaria italica] Length = 159 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -1 Query: 240 VSWFIKASLQFPVGRIGRYLKKGRYCQRLGSVAPIYLVAILEYLVAKV 97 VS +KA LQFPVGRIGRYLKKGRY QR+G+ AP+YL A+LEYL A+V Sbjct: 29 VSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAPVYLAAVLEYLAAEV 76