BLASTX nr result
ID: Akebia23_contig00047269
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00047269 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71595.1| hypothetical protein VITISV_010143 [Vitis vinifera] 54 2e-06 >emb|CAN71595.1| hypothetical protein VITISV_010143 [Vitis vinifera] Length = 1523 Score = 54.3 bits (129), Expect(2) = 2e-06 Identities = 28/57 (49%), Positives = 33/57 (57%) Frame = -1 Query: 234 QDLCSGKMIGMGIEQGGLYYLDKAQXXXXXXXXXXXXILWHQHLGYPSNKVYFIFLF 64 QDL SGKMIGMG E GLY L+ + LWHQ LG+PS+KV +F F Sbjct: 494 QDLQSGKMIGMGTESEGLYCLNLPRKGTCNVVNTKTQDLWHQRLGHPSSKVSVLFPF 550 Score = 23.1 bits (48), Expect(2) = 2e-06 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 80 ILFSCLDKNKFCHTNNCLVCLLAKH 6 +LF L +NK + C +C LAKH Sbjct: 546 VLFPFL-QNKTLDVSTCSICPLAKH 569