BLASTX nr result
ID: Akebia23_contig00047214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00047214 (801 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC95303.1| hypothetical protein BAUCODRAFT_534401 [Baudoinia... 64 6e-08 >gb|EMC95303.1| hypothetical protein BAUCODRAFT_534401 [Baudoinia compniacensis UAMH 10762] Length = 354 Score = 63.9 bits (154), Expect = 6e-08 Identities = 30/56 (53%), Positives = 37/56 (66%), Gaps = 2/56 (3%) Frame = +1 Query: 37 SSYRPTGSHGEHPTVIGNMLDPNINADG--AKKGFGVGGTSERTIRDEGAEHVKQH 198 S ++P GS G HPT+ GNM DP + ADG G GVGGT E+ IR EG EH++ H Sbjct: 11 SEWKPQGS-GPHPTLAGNMFDPGVKADGKLGSTGTGVGGTDEQAIRQEGLEHIRSH 65