BLASTX nr result
ID: Akebia23_contig00047058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00047058 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EHY51766.1| hypothetical protein HMPREF1120_11008 (mitochondr... 62 8e-08 >gb|EHY51766.1| hypothetical protein HMPREF1120_11008 (mitochondrion) [Exophiala dermatitidis NIH/UT8656] Length = 77 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +1 Query: 142 ISNSKAA*GLLV*LEVNCICTVMPISLSQS*RQLLYR*IIHAK 270 ISNSKAA GLLV LEV+ ICT +PISLSQS RQLLYR IIHA+ Sbjct: 5 ISNSKAAKGLLVYLEVSSICTAIPISLSQSSRQLLYRYIIHAR 47