BLASTX nr result
ID: Akebia23_contig00047050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00047050 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOA81656.1| hypothetical protein SETTUDRAFT_166039, partial [... 98 1e-18 gb|EUC46151.1| hypothetical protein COCMIDRAFT_4773 [Bipolaris o... 97 2e-18 gb|EMD65694.1| hypothetical protein COCSADRAFT_35731 [Bipolaris ... 97 3e-18 ref|XP_001937444.1| 60S ribosomal protein L21 [Pyrenophora triti... 96 4e-18 ref|XP_001791647.1| hypothetical protein SNOG_00986 [Phaeosphaer... 90 4e-16 gb|EMC98137.1| hypothetical protein BAUCODRAFT_32134 [Baudoinia ... 87 3e-15 ref|XP_003660224.1| hypothetical protein MYCTH_75107 [Myceliopht... 84 2e-14 ref|XP_006691695.1| 60S ribosomal protein l21-like protein [Chae... 84 2e-14 gb|EZF11974.1| hypothetical protein H100_07057 [Trichophyton rub... 83 3e-14 gb|EGE05827.1| 60S ribosomal protein [Trichophyton equinum CBS 1... 83 3e-14 ref|XP_003237659.1| 60S ribosomal protein L21 [Trichophyton rubr... 83 3e-14 ref|XP_003025613.1| hypothetical protein TRV_00253 [Trichophyton... 83 3e-14 ref|XP_003014787.1| hypothetical protein ARB_07348 [Arthroderma ... 83 3e-14 gb|ERS98230.1| hypothetical protein HMPREF1624_05013 [Sporothrix... 83 5e-14 gb|EJT79593.1| 60S ribosomal protein L21-B [Gaeumannomyces grami... 83 5e-14 gb|AEH41527.1| 60S ribosomal protein L21-B [Endocarpon pusillum] 82 6e-14 ref|XP_002842952.1| 60S ribosomal protein L21 [Arthroderma otae ... 82 6e-14 gb|EME38680.1| hypothetical protein DOTSEDRAFT_75434 [Dothistrom... 82 1e-13 gb|EKG11581.1| Ribosomal protein L21e [Macrophomina phaseolina MS6] 82 1e-13 ref|XP_003172903.1| 60S ribosomal protein L21 [Arthroderma gypse... 82 1e-13 >gb|EOA81656.1| hypothetical protein SETTUDRAFT_166039, partial [Setosphaeria turcica Et28A] Length = 146 Score = 97.8 bits (242), Expect = 1e-18 Identities = 48/62 (77%), Positives = 54/62 (87%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 +EKRINVRIEHVR SRSREDFLKRVK NFAKQQKAK+ G PQ+MKR+P PR R+VSLK Sbjct: 71 MEKRINVRIEHVRHSRSREDFLKRVKLNFAKQQKAKETGEPQQMKRAPAMPRNERVVSLK 130 Query: 183 DS 188 D+ Sbjct: 131 DN 132 >gb|EUC46151.1| hypothetical protein COCMIDRAFT_4773 [Bipolaris oryzae ATCC 44560] Length = 160 Score = 97.1 bits (240), Expect = 2e-18 Identities = 48/62 (77%), Positives = 53/62 (85%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 +EKRINVRIEHVR SRSREDFLKRVK NFAKQQKAK+ G PQ+MKR P PR R+VSLK Sbjct: 85 LEKRINVRIEHVRHSRSREDFLKRVKLNFAKQQKAKETGEPQQMKRQPAMPRGERVVSLK 144 Query: 183 DS 188 D+ Sbjct: 145 DN 146 >gb|EMD65694.1| hypothetical protein COCSADRAFT_35731 [Bipolaris sorokiniana ND90Pr] gi|451997275|gb|EMD89740.1| hypothetical protein COCHEDRAFT_1225360 [Bipolaris maydis C5] gi|477592977|gb|ENI10047.1| hypothetical protein COCC4DRAFT_126059 [Bipolaris maydis ATCC 48331] gi|576920581|gb|EUC34735.1| hypothetical protein COCCADRAFT_92660 [Bipolaris zeicola 26-R-13] gi|578484551|gb|EUN22072.1| hypothetical protein COCVIDRAFT_112348 [Bipolaris victoriae FI3] Length = 160 Score = 96.7 bits (239), Expect = 3e-18 Identities = 48/62 (77%), Positives = 53/62 (85%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 +EKRINVRIEHVR SRSREDFLKRVK NFAKQQKAK+ G PQ+MKR P PR R+VSLK Sbjct: 85 MEKRINVRIEHVRHSRSREDFLKRVKLNFAKQQKAKETGEPQQMKRQPAMPRGERVVSLK 144 Query: 183 DS 188 D+ Sbjct: 145 DN 146 >ref|XP_001937444.1| 60S ribosomal protein L21 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330931904|ref|XP_003303582.1| 60S ribosomal protein L21 [Pyrenophora teres f. teres 0-1] gi|187984543|gb|EDU50031.1| 60S ribosomal protein L21-A [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311320336|gb|EFQ88320.1| hypothetical protein PTT_15842 [Pyrenophora teres f. teres 0-1] Length = 160 Score = 96.3 bits (238), Expect = 4e-18 Identities = 49/62 (79%), Positives = 53/62 (85%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 +EKRINVRIEHVR SRSREDFLKRVK NFAKQQKAK+ G PQ+MKR P QPR IVSLK Sbjct: 85 MEKRINVRIEHVRHSRSREDFLKRVKLNFAKQQKAKETGEPQQMKRMPAQPRGESIVSLK 144 Query: 183 DS 188 D+ Sbjct: 145 DN 146 >ref|XP_001791647.1| hypothetical protein SNOG_00986 [Phaeosphaeria nodorum SN15] gi|111071361|gb|EAT92481.1| hypothetical protein SNOG_00986 [Phaeosphaeria nodorum SN15] Length = 160 Score = 89.7 bits (221), Expect = 4e-16 Identities = 45/62 (72%), Positives = 52/62 (83%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 +EKRINVRIEHVR+SRSREDFLKRVK NFA QQKAK+ G Q++KR P QP+ R VSLK Sbjct: 85 MEKRINVRIEHVRMSRSREDFLKRVKANFALQQKAKETGEKQQLKRIPKQPQGERTVSLK 144 Query: 183 DS 188 D+ Sbjct: 145 DN 146 >gb|EMC98137.1| hypothetical protein BAUCODRAFT_32134 [Baudoinia compniacensis UAMH 10762] Length = 160 Score = 86.7 bits (213), Expect = 3e-15 Identities = 44/62 (70%), Positives = 51/62 (82%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 IEKRINVRIEHVR SRSRE+FL RVKEN AK++KAK+EG +KR PV PRE+R VS K Sbjct: 85 IEKRINVRIEHVRHSRSREEFLVRVKENAAKKRKAKEEGTHMHLKRQPVVPREARTVSTK 144 Query: 183 DS 188 D+ Sbjct: 145 DN 146 >ref|XP_003660224.1| hypothetical protein MYCTH_75107 [Myceliophthora thermophila ATCC 42464] gi|347007491|gb|AEO54979.1| hypothetical protein MYCTH_75107 [Myceliophthora thermophila ATCC 42464] Length = 160 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/62 (64%), Positives = 50/62 (80%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 IEKRINVRIEH++ SRSREDFL+RVKEN ++KAK EG P ++KR P PRE+R +S K Sbjct: 85 IEKRINVRIEHIQPSRSREDFLRRVKENAELKKKAKAEGKPVQLKRQPAMPREARTISFK 144 Query: 183 DS 188 D+ Sbjct: 145 DN 146 >ref|XP_006691695.1| 60S ribosomal protein l21-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340975588|gb|EGS22703.1| 60S ribosomal protein l21-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 160 Score = 84.3 bits (207), Expect = 2e-14 Identities = 41/62 (66%), Positives = 50/62 (80%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 IEKRINVRIEHV+ SRSREDFL+RVKEN ++KAK EGVP ++KR P PRE+ VS+ Sbjct: 85 IEKRINVRIEHVKPSRSREDFLRRVKENAELKKKAKAEGVPVQLKRQPAMPREAHTVSIA 144 Query: 183 DS 188 D+ Sbjct: 145 DN 146 >gb|EZF11974.1| hypothetical protein H100_07057 [Trichophyton rubrum MR850] gi|607891805|gb|EZF31377.1| hypothetical protein H101_05012 [Trichophyton interdigitale H6] gi|607901183|gb|EZF38835.1| hypothetical protein H102_07020 [Trichophyton rubrum CBS 100081] gi|607913304|gb|EZF49467.1| hypothetical protein H103_07042 [Trichophyton rubrum CBS 288.86] gi|607925353|gb|EZF60075.1| hypothetical protein H104_06997 [Trichophyton rubrum CBS 289.86] gi|607937163|gb|EZF70596.1| hypothetical protein H105_07054 [Trichophyton soudanense CBS 452.61] gi|607949407|gb|EZF81478.1| hypothetical protein H110_07038 [Trichophyton rubrum MR1448] gi|607961429|gb|EZF92035.1| hypothetical protein H113_07092 [Trichophyton rubrum MR1459] gi|607974139|gb|EZG03405.1| hypothetical protein H106_06883 [Trichophyton rubrum CBS 735.88] gi|607985425|gb|EZG13611.1| hypothetical protein H107_07201 [Trichophyton rubrum CBS 202.88] Length = 160 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/60 (66%), Positives = 50/60 (83%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 IEKR+NVRIEH+ SRSRE+FL RVKEN K++KAK+EGV +KR PV PRE+R+VSL+ Sbjct: 85 IEKRVNVRIEHINHSRSREEFLNRVKENAVKKRKAKEEGVHVHLKRQPVGPREARVVSLE 144 >gb|EGE05827.1| 60S ribosomal protein [Trichophyton equinum CBS 127.97] Length = 152 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/60 (66%), Positives = 50/60 (83%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 IEKR+NVRIEH+ SRSRE+FL RVKEN K++KAK+EGV +KR PV PRE+R+VSL+ Sbjct: 77 IEKRVNVRIEHINHSRSREEFLNRVKENAVKKRKAKEEGVHVHLKRQPVGPREARVVSLE 136 >ref|XP_003237659.1| 60S ribosomal protein L21 [Trichophyton rubrum CBS 118892] gi|326460657|gb|EGD86110.1| 60S ribosomal protein [Trichophyton rubrum CBS 118892] gi|326471517|gb|EGD95526.1| 60S ribosomal protein [Trichophyton tonsurans CBS 112818] gi|607866633|gb|EZF11975.1| hypothetical protein H100_07057 [Trichophyton rubrum MR850] gi|607901184|gb|EZF38836.1| hypothetical protein H102_07020 [Trichophyton rubrum CBS 100081] gi|607913305|gb|EZF49468.1| hypothetical protein H103_07042 [Trichophyton rubrum CBS 288.86] gi|607925354|gb|EZF60076.1| hypothetical protein H104_06997 [Trichophyton rubrum CBS 289.86] gi|607937164|gb|EZF70597.1| hypothetical protein H105_07054 [Trichophyton soudanense CBS 452.61] gi|607949408|gb|EZF81479.1| hypothetical protein H110_07038 [Trichophyton rubrum MR1448] gi|607961430|gb|EZF92036.1| hypothetical protein H113_07092 [Trichophyton rubrum MR1459] gi|607974140|gb|EZG03406.1| hypothetical protein H106_06883 [Trichophyton rubrum CBS 735.88] gi|607985426|gb|EZG13612.1| hypothetical protein H107_07201 [Trichophyton rubrum CBS 202.88] Length = 133 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/60 (66%), Positives = 50/60 (83%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 IEKR+NVRIEH+ SRSRE+FL RVKEN K++KAK+EGV +KR PV PRE+R+VSL+ Sbjct: 58 IEKRVNVRIEHINHSRSREEFLNRVKENAVKKRKAKEEGVHVHLKRQPVGPREARVVSLE 117 >ref|XP_003025613.1| hypothetical protein TRV_00253 [Trichophyton verrucosum HKI 0517] gi|291189728|gb|EFE45002.1| hypothetical protein TRV_00253 [Trichophyton verrucosum HKI 0517] Length = 133 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/60 (66%), Positives = 50/60 (83%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 IEKR+NVRIEH+ SRSRE+FL RVKEN K++KAK+EGV +KR PV PRE+R+VSL+ Sbjct: 58 IEKRVNVRIEHINHSRSREEFLNRVKENAVKKRKAKEEGVHVHLKRQPVGPREARVVSLE 117 >ref|XP_003014787.1| hypothetical protein ARB_07348 [Arthroderma benhamiae CBS 112371] gi|291178093|gb|EFE33884.1| hypothetical protein ARB_07348 [Arthroderma benhamiae CBS 112371] Length = 133 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/60 (66%), Positives = 50/60 (83%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 IEKR+NVRIEH+ SRSRE+FL RVKEN K++KAK+EGV +KR PV PRE+R+VSL+ Sbjct: 58 IEKRVNVRIEHINHSRSREEFLNRVKENAVKKRKAKEEGVHVHLKRQPVGPREARVVSLE 117 >gb|ERS98230.1| hypothetical protein HMPREF1624_05013 [Sporothrix schenckii ATCC 58251] Length = 160 Score = 82.8 bits (203), Expect = 5e-14 Identities = 41/62 (66%), Positives = 49/62 (79%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 IEKR+NVRIEHV SRSREDFL+RVK N A +QKAK EG P ++KR PV PR +R +SL Sbjct: 85 IEKRLNVRIEHVSPSRSREDFLRRVKTNAALKQKAKAEGTPVQLKRQPVLPRAARTISLD 144 Query: 183 DS 188 D+ Sbjct: 145 DN 146 >gb|EJT79593.1| 60S ribosomal protein L21-B [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 160 Score = 82.8 bits (203), Expect = 5e-14 Identities = 39/62 (62%), Positives = 49/62 (79%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 +EKR+N+RIEHV SRSR+DFL+RVKEN A +QKAK EG P ++KR P PRE+R VS Sbjct: 85 LEKRVNLRIEHVHPSRSRDDFLRRVKENAALKQKAKAEGTPVQLKRQPAMPREARTVSTA 144 Query: 183 DS 188 D+ Sbjct: 145 DN 146 >gb|AEH41527.1| 60S ribosomal protein L21-B [Endocarpon pusillum] Length = 159 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/61 (62%), Positives = 49/61 (80%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 IEKR+NVR+EHV SRSR++FL RVKEN AK++KAK++GV +KR P PRESR +S+ Sbjct: 85 IEKRVNVRVEHVNHSRSRDEFLNRVKENAAKKKKAKEDGVHMHLKRQPAMPRESRTISMA 144 Query: 183 D 185 D Sbjct: 145 D 145 >ref|XP_002842952.1| 60S ribosomal protein L21 [Arthroderma otae CBS 113480] gi|238845554|gb|EEQ35216.1| 60S ribosomal protein L21-A [Arthroderma otae CBS 113480] Length = 160 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/60 (65%), Positives = 50/60 (83%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 IEKR+NVRIEH+ SRSRE+FL RVKEN K++KAK+EG+ +KR PV PRE+R+VSL+ Sbjct: 85 IEKRVNVRIEHINHSRSREEFLNRVKENAIKKRKAKEEGIHVHLKRQPVGPREARVVSLE 144 >gb|EME38680.1| hypothetical protein DOTSEDRAFT_75434 [Dothistroma septosporum NZE10] Length = 137 Score = 81.6 bits (200), Expect = 1e-13 Identities = 41/62 (66%), Positives = 49/62 (79%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 IEKRINVR+EHVR SRSR++FL RVK N AKQ+KAK+ G +KR PV PRE+R VS K Sbjct: 62 IEKRINVRVEHVRHSRSRDEFLTRVKTNAAKQRKAKETGEHVHLKRQPVMPREARTVSTK 121 Query: 183 DS 188 D+ Sbjct: 122 DN 123 >gb|EKG11581.1| Ribosomal protein L21e [Macrophomina phaseolina MS6] Length = 109 Score = 81.6 bits (200), Expect = 1e-13 Identities = 41/62 (66%), Positives = 50/62 (80%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 IEKRINVRIEHVR SRSRE+FL RVKEN A+++ AK EG ++KR P PRE+R VS+K Sbjct: 34 IEKRINVRIEHVRHSRSREEFLVRVKENAARRKAAKAEGKSVQLKRQPALPREARTVSMK 93 Query: 183 DS 188 D+ Sbjct: 94 DN 95 >ref|XP_003172903.1| 60S ribosomal protein L21 [Arthroderma gypseum CBS 118893] gi|311343289|gb|EFR02492.1| 60S ribosomal protein L21-A [Arthroderma gypseum CBS 118893] Length = 160 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/60 (65%), Positives = 50/60 (83%) Frame = +3 Query: 3 IEKRINVRIEHVRLSRSREDFLKRVKENFAKQQKAKKEGVPQKMKRSPVQPRESRIVSLK 182 IEKR+NVRIEH+ SRSRE+FL RVKEN K++K+K+EGV +KR PV PRE+R+VSL+ Sbjct: 85 IEKRVNVRIEHINHSRSREEFLNRVKENAIKKRKSKEEGVHVHLKRQPVGPREARVVSLE 144