BLASTX nr result
ID: Akebia23_contig00044768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00044768 (299 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519625.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002519625.1| conserved hypothetical protein [Ricinus communis] gi|223541215|gb|EEF42770.1| conserved hypothetical protein [Ricinus communis] Length = 121 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/58 (46%), Positives = 38/58 (65%) Frame = +3 Query: 21 KKLEASNTKYKKKVETY*RYVSFDVGDLLLVCWYKERFPIEASNKLKHKKVGPCQCIQ 194 +K+E +N KYK E + ++ FDVGD +++ KER PI SNK K KK GPC+ I+ Sbjct: 2 RKIEKANAKYKVVAEMHRKHKVFDVGDEVIIFLRKERIPIGHSNKFKPKKYGPCKIIK 59