BLASTX nr result
ID: Akebia23_contig00044708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00044708 (231 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61640.1| hypothetical protein VITISV_021909 [Vitis vinifera] 65 8e-09 emb|CAN71108.1| hypothetical protein VITISV_001478 [Vitis vinifera] 62 1e-07 emb|CAN70473.1| hypothetical protein VITISV_037490 [Vitis vinifera] 60 2e-07 gb|AAD14478.1| Strong similarity to gb|AF039376 Evelknievel retr... 60 3e-07 gb|ACP30598.1| disease resistance protein [Brassica rapa subsp. ... 60 3e-07 emb|CAN66496.1| hypothetical protein VITISV_036886 [Vitis vinifera] 60 4e-07 gb|AAT39281.2| Integrase core domain containing protein [Solanum... 59 5e-07 emb|CAN62447.1| hypothetical protein VITISV_024007 [Vitis vinifera] 59 7e-07 emb|CAN83877.1| hypothetical protein VITISV_014760 [Vitis vinifera] 59 9e-07 emb|CAN74381.1| hypothetical protein VITISV_007944 [Vitis vinifera] 59 9e-07 emb|CAB43904.1| putative protein [Arabidopsis thaliana] gi|72697... 59 9e-07 dbj|BAB10876.1| polyprotein [Arabidopsis thaliana] 58 1e-06 emb|CAN81844.1| hypothetical protein VITISV_005376 [Vitis vinifera] 58 1e-06 emb|CAN64418.1| hypothetical protein VITISV_030041 [Vitis vinifera] 58 1e-06 gb|AAL78658.1|AF405555_1 Hopscotch polyprotein [Fagus sylvatica] 58 1e-06 gb|AAC35532.1| contains similarity to proteases [Arabidopsis tha... 58 2e-06 emb|CAB46043.1| retrotransposon like protein [Arabidopsis thalia... 58 2e-06 emb|CAB40035.1| retrotransposon like protein [Arabidopsis thalia... 58 2e-06 ref|XP_007014689.1| Uncharacterized protein TCM_040047 [Theobrom... 57 2e-06 emb|CAN62533.1| hypothetical protein VITISV_030700 [Vitis vinifera] 57 2e-06 >emb|CAN61640.1| hypothetical protein VITISV_021909 [Vitis vinifera] Length = 1361 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGYS 188 YSMLR FGC CFPYL Y NK+SPKS PCVFLGYS Sbjct: 640 YSMLRTFGCLCFPYLRDYSPNKLSPKSTPCVFLGYS 675 >emb|CAN71108.1| hypothetical protein VITISV_001478 [Vitis vinifera] Length = 1354 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 4/44 (9%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGY----SQYLC 200 YS L+VFGC C+P+L PY T+K++P S PCVFLGY S YLC Sbjct: 659 YSRLKVFGCLCYPWLRPYXTHKLTPXSKPCVFLGYSLSQSAYLC 702 >emb|CAN70473.1| hypothetical protein VITISV_037490 [Vitis vinifera] Length = 786 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/45 (55%), Positives = 32/45 (71%), Gaps = 4/45 (8%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGY----SQYLCY 203 YS LR+FGC C+P+L PY + K+ +S PC+FLGY S YLCY Sbjct: 380 YSKLRIFGCLCYPWLRPYSSRKLESRSKPCIFLGYSLTQSAYLCY 424 >gb|AAD14478.1| Strong similarity to gb|AF039376 Evelknievel retrotransposon polyprotein from Arabidopsis arenosa [Arabidopsis thaliana] Length = 1194 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 4/44 (9%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGYSQ----YLC 200 Y LRVFGC CFP+L PY T+K+ + PCVFLGYSQ YLC Sbjct: 642 YLKLRVFGCLCFPWLRPYTTHKLDDRPAPCVFLGYSQTQSAYLC 685 >gb|ACP30598.1| disease resistance protein [Brassica rapa subsp. pekinensis] Length = 2301 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGYSQ 191 Y LR+FGC CFP L PY NK+ P+SL CVFLGYS+ Sbjct: 685 YDALRIFGCACFPMLRPYTQNKLDPRSLQCVFLGYSE 721 >emb|CAN66496.1| hypothetical protein VITISV_036886 [Vitis vinifera] Length = 1092 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGYS 188 Y LR FGC C+P+L YRTNK+ PKS PCVFLGYS Sbjct: 555 YHKLRTFGCQCYPWLVXYRTNKLQPKSQPCVFLGYS 590 >gb|AAT39281.2| Integrase core domain containing protein [Solanum demissum] Length = 1760 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGYS-QYLCY 203 Y LRVFGC C+P+L PY NK+ PKS PCV+LG+S ++ C+ Sbjct: 660 YESLRVFGCLCYPWLKPYAKNKLEPKSTPCVYLGFSTKHYCH 701 >emb|CAN62447.1| hypothetical protein VITISV_024007 [Vitis vinifera] Length = 1144 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGYSQ 191 Y LR FGC C+P PY T+K+ PKS+PC+FLGYSQ Sbjct: 633 YLKLRKFGCLCYPLTRPYNTHKLQPKSIPCIFLGYSQ 669 >emb|CAN83877.1| hypothetical protein VITISV_014760 [Vitis vinifera] Length = 707 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGYS 188 YSM R FGC CFPYL Y NK+SPKS P VFLGYS Sbjct: 96 YSMPRTFGCLCFPYLRDYSPNKLSPKSTPYVFLGYS 131 >emb|CAN74381.1| hypothetical protein VITISV_007944 [Vitis vinifera] Length = 1884 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGYS 188 Y LR+FGC CFPYL Y NK SPK+ PCVF+GYS Sbjct: 626 YRSLRIFGCQCFPYLRDYGKNKFSPKTYPCVFIGYS 661 >emb|CAB43904.1| putative protein [Arabidopsis thaliana] gi|7269745|emb|CAB81478.1| putative protein [Arabidopsis thaliana] Length = 1415 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/46 (54%), Positives = 32/46 (69%), Gaps = 4/46 (8%) Frame = +3 Query: 78 IYSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGYSQ----YLCY 203 +Y+ LRVFGC C+P L PY +NK PKSL CVF GY++ Y C+ Sbjct: 646 VYTSLRVFGCACYPNLRPYASNKFDPKSLLCVFTGYNEKYKGYKCF 691 >dbj|BAB10876.1| polyprotein [Arabidopsis thaliana] Length = 1429 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/47 (57%), Positives = 31/47 (65%), Gaps = 4/47 (8%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGY----SQYLCYPI 209 Y LRVFGC C+P+L PY TNK+ +S CVFLGY S YLC I Sbjct: 668 YLKLRVFGCLCYPWLRPYNTNKLEARSTMCVFLGYSLTQSAYLCLDI 714 >emb|CAN81844.1| hypothetical protein VITISV_005376 [Vitis vinifera] Length = 762 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGYS 188 Y LR FGC C+P+L PY NK PKS PCVFLGYS Sbjct: 373 YHKLRTFGCQCYPWLVPYHANKFQPKSQPCVFLGYS 408 >emb|CAN64418.1| hypothetical protein VITISV_030041 [Vitis vinifera] Length = 1429 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/44 (56%), Positives = 29/44 (65%), Gaps = 4/44 (9%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGY----SQYLC 200 Y LR FGC CFP + PY TNK KS+PC+F+GY S YLC Sbjct: 542 YEKLRSFGCLCFPLMKPYNTNKFQKKSVPCIFVGYSTSQSAYLC 585 >gb|AAL78658.1|AF405555_1 Hopscotch polyprotein [Fagus sylvatica] Length = 226 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGYS 188 Y+ L+VFGC CFPYL Y NK PKS PC+F+GYS Sbjct: 154 YNSLKVFGCRCFPYLRDYAKNKFEPKSYPCIFIGYS 189 >gb|AAC35532.1| contains similarity to proteases [Arabidopsis thaliana] Length = 1392 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +3 Query: 78 IYSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGYS 188 +Y+ LRVFG C+PYL PY NK PKSL CVFLGY+ Sbjct: 680 VYTALRVFGSACYPYLRPYAKNKFDPKSLLCVFLGYN 716 >emb|CAB46043.1| retrotransposon like protein [Arabidopsis thaliana] gi|7268438|emb|CAB80958.1| retrotransposon like protein [Arabidopsis thaliana] Length = 1474 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/47 (55%), Positives = 31/47 (65%), Gaps = 4/47 (8%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGYS----QYLCYPI 209 Y LRVFGC CFP+L PY NK+ +S CVFLGYS YLC+ + Sbjct: 686 YERLRVFGCLCFPWLRPYTHNKLEERSRRCVFLGYSLTQTAYLCFDV 732 >emb|CAB40035.1| retrotransposon like protein [Arabidopsis thaliana] gi|7267767|emb|CAB81170.1| retrotransposon like protein [Arabidopsis thaliana] Length = 1515 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +3 Query: 78 IYSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGYS 188 +Y+ LRVFG C+PYL PY NK PKSL CVFLGY+ Sbjct: 677 VYTALRVFGSACYPYLRPYAKNKFDPKSLLCVFLGYN 713 >ref|XP_007014689.1| Uncharacterized protein TCM_040047 [Theobroma cacao] gi|508785052|gb|EOY32308.1| Uncharacterized protein TCM_040047 [Theobroma cacao] Length = 678 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/45 (55%), Positives = 31/45 (68%), Gaps = 4/45 (8%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGY----SQYLCY 203 YS L+VFGC C+P+L PY +K+ PKS PCVFL Y S Y C+ Sbjct: 396 YSKLKVFGCLCYPWLKPYNKHKLQPKSKPCVFLRYSINQSAYKCF 440 >emb|CAN62533.1| hypothetical protein VITISV_030700 [Vitis vinifera] Length = 731 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/45 (51%), Positives = 31/45 (68%), Gaps = 4/45 (8%) Frame = +3 Query: 81 YSMLRVFGCCCFPYLGPYRTNKVSPKSLPCVFLGY----SQYLCY 203 YS L++FGC C+P+L PY ++K+ S PC+FLGY S Y CY Sbjct: 507 YSKLKIFGCLCYPWLRPYSSHKLDSSSKPCIFLGYSLTQSAYFCY 551