BLASTX nr result
ID: Akebia23_contig00044657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00044657 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003843801.1| hypothetical protein LEMA_P014520.1 [Leptosp... 41 1e-06 >ref|XP_003843801.1| hypothetical protein LEMA_P014520.1 [Leptosphaeria maculans JN3] gi|312220381|emb|CBY00322.1| hypothetical protein LEMA_P014520.1 [Leptosphaeria maculans JN3] Length = 726 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 24/37 (64%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +1 Query: 145 HFSAQSLVYSSLRTTSLTPFTDVPYKP-HSAAGKRQP 252 HF+AQSLVYS LR TSLT T P P AAG RQP Sbjct: 161 HFAAQSLVYSPLRATSLTSTTVGPLHPLPLAAGTRQP 197 Score = 36.6 bits (83), Expect(2) = 1e-06 Identities = 22/36 (61%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = +3 Query: 12 DNTRYT--PPPAFIFYT*TSRSPRLLDPILPQGIGI 113 DNTRY PP SR PRLLDPIL QGIGI Sbjct: 116 DNTRYNHLPPTHVSSSPPLSRFPRLLDPILFQGIGI 151