BLASTX nr result
ID: Akebia23_contig00044513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00044513 (474 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534745.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 >ref|XP_002534745.1| conserved hypothetical protein [Ricinus communis] gi|223524642|gb|EEF27636.1| conserved hypothetical protein [Ricinus communis] Length = 98 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/38 (86%), Positives = 33/38 (86%) Frame = +1 Query: 229 HLVVFFLVVDTDKTQPDDVCWLVVRGLLVPPAYPKGGA 342 HLVVFFLVVDT KTQPDDV WLVVRGLLV AYPKG A Sbjct: 61 HLVVFFLVVDTGKTQPDDVYWLVVRGLLV-SAYPKGDA 97