BLASTX nr result
ID: Akebia23_contig00044353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00044353 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001267726.1| APSES transcription factor StuA [Aspergillus... 56 5e-06 >ref|XP_001267726.1| APSES transcription factor StuA [Aspergillus clavatus NRRL 1] gi|119395868|gb|EAW06300.1| APSES transcription factor StuA [Aspergillus clavatus NRRL 1] Length = 643 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/80 (40%), Positives = 42/80 (52%), Gaps = 2/80 (2%) Frame = +2 Query: 2 IDTSLSNARSVXXXXXXXXXXXXMQNMSGYPTSGAYDSGRPIYGHA--SQPSYGSQQYGM 175 IDT+LSNARS+ +Q M Y + YD+ +P Y A S P Y QQ M Sbjct: 346 IDTTLSNARSMPTTPATTPPGNGLQGMQSYQSQAGYDASKPYYSAAPPSHPHYAPQQ-PM 404 Query: 176 SRFGAVQPSPGGVKHEMGPP 235 S++G PS +K+EM PP Sbjct: 405 SQYGQSMPSNPYIKNEMAPP 424