BLASTX nr result
ID: Akebia23_contig00042802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00042802 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN08144.1| RNA-directed DNA polymerase ; HMG-I and HMG-Y, DN... 49 3e-06 gb|ABN08556.1| Polyprotein, putative [Medicago truncatula] 48 3e-06 emb|CCH50976.1| T4.15 [Malus x robusta] 47 5e-06 gb|ABN09815.1| hypothetical protein MtrDRAFT_AC167711g37v2 [Medi... 47 5e-06 >gb|ABN08144.1| RNA-directed DNA polymerase ; HMG-I and HMG-Y, DNA-binding, putative [Medicago truncatula] Length = 195 Score = 48.5 bits (114), Expect(2) = 3e-06 Identities = 22/41 (53%), Positives = 28/41 (68%) Frame = +1 Query: 19 WRGAS*VLMD*HIPIKLKEIFYKMAIRTAIFYGDESWEIKN 141 WR AS VL D +P+KLK FY+ AIR A+ YG E W +K+ Sbjct: 109 WRRASGVLCDKKVPLKLKGKFYRTAIRPALLYGTECWAVKS 149 Score = 28.1 bits (61), Expect(2) = 3e-06 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +3 Query: 135 QEQHVHSLDVAKKNLLR*MSQKTKNDIIINDYSHE 239 + QH + + V + +LR MS KT+ D I ND E Sbjct: 148 KSQHENQVSVTEMRMLRWMSGKTRQDRIRNDTIRE 182 >gb|ABN08556.1| Polyprotein, putative [Medicago truncatula] Length = 137 Score = 48.1 bits (113), Expect(2) = 3e-06 Identities = 21/41 (51%), Positives = 28/41 (68%) Frame = +1 Query: 19 WRGAS*VLMD*HIPIKLKEIFYKMAIRTAIFYGDESWEIKN 141 WR AS VL D +P+KLK FY+ A+R A+ YG E W +K+ Sbjct: 37 WRRASGVLCDKKVPLKLKGKFYRTAVRPALLYGTECWAVKS 77 Score = 28.5 bits (62), Expect(2) = 3e-06 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 135 QEQHVHSLDVAKKNLLR*MSQKTKNDIIINDYSHE 239 + QH + + V + +LR MS KT++D I ND E Sbjct: 76 KSQHENQVSVVEMRMLRWMSGKTRHDRIRNDTIRE 110 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 47.4 bits (111), Expect(2) = 5e-06 Identities = 21/41 (51%), Positives = 28/41 (68%) Frame = +1 Query: 19 WRGAS*VLMD*HIPIKLKEIFYKMAIRTAIFYGDESWEIKN 141 W+ AS VL D +P+KLK FY+ AIR A+ YG E W +K+ Sbjct: 825 WKSASGVLCDRRMPLKLKGKFYRTAIRPAMLYGTECWAVKH 865 Score = 28.5 bits (62), Expect(2) = 5e-06 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 135 QEQHVHSLDVAKKNLLR*MSQKTKNDIIIND 227 + QHVH + VA+ +LR M T+ D I N+ Sbjct: 864 KHQHVHKMGVAEMRMLRWMCGHTRKDKIRNE 894 >gb|ABN09815.1| hypothetical protein MtrDRAFT_AC167711g37v2 [Medicago truncatula] Length = 104 Score = 46.6 bits (109), Expect(2) = 5e-06 Identities = 20/41 (48%), Positives = 27/41 (65%) Frame = +1 Query: 19 WRGAS*VLMD*HIPIKLKEIFYKMAIRTAIFYGDESWEIKN 141 WR AS VL D +P+KLK FY+ +R A+ YG E W +K+ Sbjct: 18 WRRASSVLCDKKVPLKLKGKFYRTTVRPALLYGTECWAVKS 58 Score = 29.3 bits (64), Expect(2) = 5e-06 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 135 QEQHVHSLDVAKKNLLR*MSQKTKNDIIINDYSHE 239 + QH + + VA+ +LR MS KT+ D I ND E Sbjct: 57 KSQHENQISVAEMMMLRWMSGKTRQDRIRNDTIRE 91