BLASTX nr result
ID: Akebia23_contig00042776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00042776 (499 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001795446.1| hypothetical protein SNOG_05034 [Phaeosphaer... 58 1e-06 >ref|XP_001795446.1| hypothetical protein SNOG_05034 [Phaeosphaeria nodorum SN15] gi|160706499|gb|EAT87425.2| hypothetical protein SNOG_05034 [Phaeosphaeria nodorum SN15] Length = 621 Score = 58.2 bits (139), Expect = 1e-06 Identities = 33/67 (49%), Positives = 39/67 (58%), Gaps = 5/67 (7%) Frame = -3 Query: 305 TSSGVEIAKTPVSEVTHTVTETLVYTVGVGSTAHPXXXXXXXXXXXTIYQTIVVT----- 141 ++ GV ++ PVSEV T TETLVYT+GVGSTAHP T Y T+VVT Sbjct: 396 SAPGVVTSQVPVSEVVKTKTETLVYTIGVGSTAHPVTTEVVSTSTSTAYSTVVVTIRKSS 455 Query: 140 RPGGGYG 120 P GG G Sbjct: 456 TPAGGNG 462