BLASTX nr result
ID: Akebia23_contig00042758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00042758 (461 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007587859.1| putative 40s ribosomal protein s27 protein [... 68 2e-09 gb|EMD89743.1| hypothetical protein COCHEDRAFT_9327 [Bipolaris m... 68 2e-09 gb|EMD65691.1| hypothetical protein COCSADRAFT_35728 [Bipolaris ... 68 2e-09 gb|EKG11584.1| Ribosomal protein S27e [Macrophomina phaseolina MS6] 68 2e-09 ref|XP_003303585.1| 40S ribosomal protein S27 [Pyrenophora teres... 68 2e-09 ref|XP_001791644.1| hypothetical protein SNOG_00983 [Phaeosphaer... 68 2e-09 gb|EMC98021.1| hypothetical protein BAUCODRAFT_32024, partial [B... 65 8e-09 ref|XP_003847709.1| 40S ribosomal protein S27 [Zymoseptoria trit... 65 8e-09 ref|XP_006691976.1| ribosomal protein s27-like protein [Chaetomi... 64 2e-08 gb|EYB22000.1| hypothetical protein FG05_06407, partial [Fusariu... 64 2e-08 ref|XP_007600989.1| 40S ribosomal protein S27 [Colletotrichum fi... 64 2e-08 ref|XP_386583.1| hypothetical protein FG06407.1 [Fusarium gramin... 64 2e-08 gb|ETS84831.1| 40S ribosomal protein S27 [Pestalotiopsis fici W1... 64 2e-08 gb|ERS99995.1| 40S ribosomal protein S27 [Sporothrix schenckii A... 64 2e-08 gb|EQB47349.1| hypothetical protein CGLO_13525 [Colletotrichum g... 64 2e-08 gb|EPE07515.1| 40s ribosomal protein s27 [Ophiostoma piceae UAMH... 64 2e-08 gb|EMR70947.1| putative 40s ribosomal protein s27 protein [Eutyp... 64 2e-08 gb|EME38718.1| zinc-binding ribosomal protein S27e-like protein ... 64 2e-08 gb|AAY85811.1| 40S ribosomal protein S27 [Chaetomium globosum] 64 2e-08 emb|CCE27294.1| probable 40S ribosomal protein S27-2 [Claviceps ... 64 2e-08 >ref|XP_007587859.1| putative 40s ribosomal protein s27 protein [Neofusicoccum parvum UCRNP2] gi|485917878|gb|EOD44675.1| putative 40s ribosomal protein s27 protein [Neofusicoccum parvum UCRNP2] Length = 82 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 53 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >gb|EMD89743.1| hypothetical protein COCHEDRAFT_9327 [Bipolaris maydis C5] gi|477592974|gb|ENI10044.1| hypothetical protein COCC4DRAFT_29847 [Bipolaris maydis ATCC 48331] gi|576920577|gb|EUC34731.1| hypothetical protein COCCADRAFT_35661 [Bipolaris zeicola 26-R-13] gi|576927961|gb|EUC41623.1| hypothetical protein COCMIDRAFT_40237 [Bipolaris oryzae ATCC 44560] gi|578484555|gb|EUN22076.1| hypothetical protein COCVIDRAFT_42089 [Bipolaris victoriae FI3] Length = 82 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 53 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >gb|EMD65691.1| hypothetical protein COCSADRAFT_35728 [Bipolaris sorokiniana ND90Pr] Length = 82 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 53 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >gb|EKG11584.1| Ribosomal protein S27e [Macrophomina phaseolina MS6] Length = 82 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 53 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_003303585.1| 40S ribosomal protein S27 [Pyrenophora teres f. teres 0-1] gi|311320339|gb|EFQ88323.1| hypothetical protein PTT_15845 [Pyrenophora teres f. teres 0-1] Length = 137 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 108 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 137 >ref|XP_001791644.1| hypothetical protein SNOG_00983 [Phaeosphaeria nodorum SN15] gi|189202210|ref|XP_001937441.1| 40S ribosomal protein S27 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|396468832|ref|XP_003838268.1| similar to 40s ribosomal protein s27 [Leptosphaeria maculans JN3] gi|111071358|gb|EAT92478.1| hypothetical protein SNOG_00983 [Phaeosphaeria nodorum SN15] gi|187984540|gb|EDU50028.1| 40S ribosomal protein S27 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|312214835|emb|CBX94789.1| similar to 40s ribosomal protein s27 [Leptosphaeria maculans JN3] gi|482804547|gb|EOA81659.1| hypothetical protein SETTUDRAFT_157561 [Setosphaeria turcica Et28A] Length = 82 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 53 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 82 >gb|EMC98021.1| hypothetical protein BAUCODRAFT_32024, partial [Baudoinia compniacensis UAMH 10762] Length = 81 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 52 VVVCAGCSQVLCQPTGGKARLTEGCSFRRK 81 >ref|XP_003847709.1| 40S ribosomal protein S27 [Zymoseptoria tritici IPO323] gi|339467582|gb|EGP82685.1| hypothetical protein MYCGRDRAFT_64763 [Zymoseptoria tritici IPO323] gi|452986834|gb|EME86590.1| hypothetical protein MYCFIDRAFT_210543 [Pseudocercospora fijiensis CIRAD86] gi|453079947|gb|EMF07999.1| 40S ribosomal protein S27 [Sphaerulina musiva SO2202] Length = 82 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VVVC GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 53 VVVCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >ref|XP_006691976.1| ribosomal protein s27-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] gi|340975869|gb|EGS22984.1| ribosomal protein s27-like protein [Chaetomium thermophilum var. thermophilum DSM 1495] Length = 82 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VV+CQGC+ VLCQPTGGKARLTEGCSFRRK Sbjct: 53 VVICQGCTNVLCQPTGGKARLTEGCSFRRK 82 >gb|EYB22000.1| hypothetical protein FG05_06407, partial [Fusarium graminearum] Length = 81 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VV+CQGC+ VLCQPTGGKARLTEGCSFRRK Sbjct: 52 VVICQGCTTVLCQPTGGKARLTEGCSFRRK 81 >ref|XP_007600989.1| 40S ribosomal protein S27 [Colletotrichum fioriniae PJ7] gi|588893109|gb|EXF75301.1| 40S ribosomal protein S27 [Colletotrichum fioriniae PJ7] Length = 93 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VV+CQGC+ VLCQPTGGKARLTEGCSFRRK Sbjct: 64 VVICQGCTTVLCQPTGGKARLTEGCSFRRK 93 >ref|XP_386583.1| hypothetical protein FG06407.1 [Fusarium graminearum PH-1] Length = 75 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VV+CQGC+ VLCQPTGGKARLTEGCSFRRK Sbjct: 46 VVICQGCTTVLCQPTGGKARLTEGCSFRRK 75 >gb|ETS84831.1| 40S ribosomal protein S27 [Pestalotiopsis fici W106-1] Length = 100 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VV+CQGC+ VLCQPTGGKARLTEGCSFRRK Sbjct: 71 VVICQGCTTVLCQPTGGKARLTEGCSFRRK 100 >gb|ERS99995.1| 40S ribosomal protein S27 [Sporothrix schenckii ATCC 58251] Length = 132 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VV+CQGC+ VLCQPTGGKARLTEGCSFRRK Sbjct: 103 VVICQGCTTVLCQPTGGKARLTEGCSFRRK 132 >gb|EQB47349.1| hypothetical protein CGLO_13525 [Colletotrichum gloeosporioides Cg-14] Length = 88 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VV+CQGC+ VLCQPTGGKARLTEGCSFRRK Sbjct: 59 VVICQGCTTVLCQPTGGKARLTEGCSFRRK 88 >gb|EPE07515.1| 40s ribosomal protein s27 [Ophiostoma piceae UAMH 11346] Length = 99 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VV+CQGC+ VLCQPTGGKARLTEGCSFRRK Sbjct: 70 VVICQGCTTVLCQPTGGKARLTEGCSFRRK 99 >gb|EMR70947.1| putative 40s ribosomal protein s27 protein [Eutypa lata UCREL1] Length = 82 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VV+CQGC+ VLCQPTGGKARLTEGCSFRRK Sbjct: 53 VVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >gb|EME38718.1| zinc-binding ribosomal protein S27e-like protein [Dothistroma septosporum NZE10] Length = 82 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VV C GCSQVLCQPTGGKARLTEGCSFRRK Sbjct: 53 VVTCAGCSQVLCQPTGGKARLTEGCSFRRK 82 >gb|AAY85811.1| 40S ribosomal protein S27 [Chaetomium globosum] Length = 82 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VV+CQGC+ VLCQPTGGKARLTEGCSFRRK Sbjct: 53 VVICQGCTTVLCQPTGGKARLTEGCSFRRK 82 >emb|CCE27294.1| probable 40S ribosomal protein S27-2 [Claviceps purpurea 20.1] Length = 82 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 460 VVVCQGCSQVLCQPTGGKARLTEGCSFRRK 371 VV+CQGC+ VLCQPTGGKARLTEGCSFRRK Sbjct: 53 VVICQGCTTVLCQPTGGKARLTEGCSFRRK 82