BLASTX nr result
ID: Akebia23_contig00042560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00042560 (279 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26927.3| unnamed protein product [Vitis vinifera] 67 3e-09 ref|XP_002280374.1| PREDICTED: uncharacterized protein LOC100249... 67 3e-09 gb|EXB65612.1| Uncharacterized transporter [Morus notabilis] 67 3e-09 ref|XP_002526597.1| auxin:hydrogen symporter, putative [Ricinus ... 65 7e-09 ref|XP_002312429.2| auxin efflux carrier family protein [Populus... 65 1e-08 ref|XP_006448301.1| hypothetical protein CICLE_v10015208mg [Citr... 63 4e-08 ref|XP_007045070.1| Auxin efflux carrier family protein [Theobro... 63 4e-08 ref|XP_007225188.1| hypothetical protein PRUPE_ppa002140mg [Prun... 62 8e-08 ref|NP_565011.1| auxin efflux carrier family protein [Arabidopsi... 62 1e-07 ref|XP_002887344.1| auxin efflux carrier family protein [Arabido... 61 2e-07 ref|XP_002314817.1| auxin efflux carrier family protein [Populus... 60 2e-07 ref|XP_006390805.1| hypothetical protein EUTSA_v10018516mg [Eutr... 59 5e-07 emb|CAN75911.1| hypothetical protein VITISV_019392 [Vitis vinifera] 59 7e-07 ref|XP_006357795.1| PREDICTED: uncharacterized protein LOC102601... 59 9e-07 ref|XP_004232008.1| PREDICTED: uncharacterized protein LOC101262... 59 9e-07 ref|XP_006383361.1| hypothetical protein POPTR_0005s14850g [Popu... 58 2e-06 ref|XP_006300471.1| hypothetical protein CARUB_v10020273mg [Caps... 58 2e-06 gb|EMS47209.1| Protein DEHYDRATION-INDUCED 19-like protein 5 [Tr... 57 2e-06 dbj|BAJ94383.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 2e-06 ref|XP_002305851.1| hypothetical protein POPTR_0004s09210g [Popu... 57 2e-06 >emb|CBI26927.3| unnamed protein product [Vitis vinifera] Length = 406 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -2 Query: 116 ENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 E+L SAVVPLLKLLSLTVIGLVLAHPKTQ++PR+TFKL Sbjct: 6 EDLVSAVVPLLKLLSLTVIGLVLAHPKTQMIPRSTFKL 43 >ref|XP_002280374.1| PREDICTED: uncharacterized protein LOC100249273 [Vitis vinifera] Length = 436 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -2 Query: 116 ENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 E+L SAVVPLLKLLSLTVIGLVLAHPKTQ++PR+TFKL Sbjct: 6 EDLVSAVVPLLKLLSLTVIGLVLAHPKTQMIPRSTFKL 43 >gb|EXB65612.1| Uncharacterized transporter [Morus notabilis] Length = 452 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/38 (81%), Positives = 38/38 (100%) Frame = -2 Query: 116 ENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 E+L+SA++PLLKLL+LTVIGLVLAHPKTQI+P+ATFKL Sbjct: 19 EDLKSAILPLLKLLALTVIGLVLAHPKTQIIPKATFKL 56 >ref|XP_002526597.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223534037|gb|EEF35756.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 451 Score = 65.5 bits (158), Expect = 7e-09 Identities = 35/55 (63%), Positives = 40/55 (72%), Gaps = 11/55 (20%) Frame = -2 Query: 134 MSGFLE-----------ENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 MSGFL ENL +A+VPL+KLLSLTVIGLVL HPKTQI P+ATF+L Sbjct: 1 MSGFLSALPGNNLKSSGENLATAIVPLMKLLSLTVIGLVLGHPKTQITPKATFRL 55 >ref|XP_002312429.2| auxin efflux carrier family protein [Populus trichocarpa] gi|550332927|gb|EEE89796.2| auxin efflux carrier family protein [Populus trichocarpa] Length = 449 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -2 Query: 116 ENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 ENL +A+VPL+KLLSLTVIGLVLAHPK Q++PRATF+L Sbjct: 18 ENLLTAIVPLMKLLSLTVIGLVLAHPKAQMIPRATFRL 55 >ref|XP_006448301.1| hypothetical protein CICLE_v10015208mg [Citrus clementina] gi|568829001|ref|XP_006468822.1| PREDICTED: uncharacterized protein LOC102628002 [Citrus sinensis] gi|557550912|gb|ESR61541.1| hypothetical protein CICLE_v10015208mg [Citrus clementina] Length = 452 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = -2 Query: 119 EENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 E+N+ SA++PLLKLLSLTVIGL+LAHP+ Q++PRATF+L Sbjct: 17 EQNVLSAILPLLKLLSLTVIGLILAHPRQQMIPRATFRL 55 >ref|XP_007045070.1| Auxin efflux carrier family protein [Theobroma cacao] gi|508709005|gb|EOY00902.1| Auxin efflux carrier family protein [Theobroma cacao] Length = 450 Score = 63.2 bits (152), Expect = 4e-08 Identities = 39/53 (73%), Positives = 43/53 (81%) Frame = -2 Query: 161 ISKNIKERKMSGFLEENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 I+KN K SG E+L SAV PL+KLLSLTVIGLVLAHPKTQI+PRATFKL Sbjct: 8 IAKN--NMKSSG---EDLLSAV-PLMKLLSLTVIGLVLAHPKTQIIPRATFKL 54 >ref|XP_007225188.1| hypothetical protein PRUPE_ppa002140mg [Prunus persica] gi|462422124|gb|EMJ26387.1| hypothetical protein PRUPE_ppa002140mg [Prunus persica] Length = 710 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/37 (75%), Positives = 36/37 (97%) Frame = -2 Query: 113 NLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 ++ SA+VPL+KLLSLTVIGLVL+HPK+Q++PRATFKL Sbjct: 18 DVMSAIVPLMKLLSLTVIGLVLSHPKSQMIPRATFKL 54 >ref|NP_565011.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|12323438|gb|AAG51701.1|AC016972_20 hypothetical protein; 37307-38680 [Arabidopsis thaliana] gi|15028381|gb|AAK76667.1| unknown protein [Arabidopsis thaliana] gi|19310751|gb|AAL85106.1| unknown protein [Arabidopsis thaliana] gi|332197039|gb|AEE35160.1| auxin efflux carrier family protein [Arabidopsis thaliana] Length = 457 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 7/51 (13%) Frame = -2 Query: 134 MSGFLEENLQS-------AVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 MSGF N+ S VVPLLKL+ LTVIGL+LAHPKTQ+VPRATF+L Sbjct: 1 MSGFSSGNVNSRVVDILSGVVPLLKLICLTVIGLLLAHPKTQLVPRATFRL 51 >ref|XP_002887344.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. lyrata] gi|297333185|gb|EFH63603.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. lyrata] Length = 457 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 7/51 (13%) Frame = -2 Query: 134 MSGFLEENLQS-------AVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 MSGF N+ S VVPLLKL+ LTVIGL+LAHPKTQ+VPRATF+L Sbjct: 1 MSGFSGGNVNSRVVDILSGVVPLLKLICLTVIGLLLAHPKTQLVPRATFRL 51 >ref|XP_002314817.1| auxin efflux carrier family protein [Populus trichocarpa] gi|222863857|gb|EEF00988.1| auxin efflux carrier family protein [Populus trichocarpa] Length = 449 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 116 ENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 ENL +A+VPL+KLLSL VIGLVLAHPK Q++PR TF+L Sbjct: 18 ENLLTAIVPLMKLLSLIVIGLVLAHPKAQMIPRETFRL 55 >ref|XP_006390805.1| hypothetical protein EUTSA_v10018516mg [Eutrema salsugineum] gi|557087239|gb|ESQ28091.1| hypothetical protein EUTSA_v10018516mg [Eutrema salsugineum] Length = 459 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/38 (68%), Positives = 35/38 (92%) Frame = -2 Query: 116 ENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 E++ S +VPL+KL+ LT+IGL+LAHPKTQ+VPRATF+L Sbjct: 18 EDILSGIVPLMKLICLTLIGLLLAHPKTQLVPRATFRL 55 >emb|CAN75911.1| hypothetical protein VITISV_019392 [Vitis vinifera] Length = 487 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 116 ENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 EN SAVVPL+KLLSLTVIGL+LAHPK Q++ +ATF+L Sbjct: 17 ENWLSAVVPLMKLLSLTVIGLILAHPKLQVMSKATFRL 54 >ref|XP_006357795.1| PREDICTED: uncharacterized protein LOC102601189 [Solanum tuberosum] Length = 452 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 101 AVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 AV+PLLKLL LTVIGL+LAHP+TQ+VP+ATFKL Sbjct: 22 AVLPLLKLLCLTVIGLILAHPRTQLVPKATFKL 54 >ref|XP_004232008.1| PREDICTED: uncharacterized protein LOC101262162 [Solanum lycopersicum] Length = 452 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 101 AVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 AV+PLLKLL LTVIGL+LAHP+TQ+VP+ATFKL Sbjct: 22 AVLPLLKLLCLTVIGLILAHPRTQLVPKATFKL 54 >ref|XP_006383361.1| hypothetical protein POPTR_0005s14850g [Populus trichocarpa] gi|550338970|gb|ERP61158.1| hypothetical protein POPTR_0005s14850g [Populus trichocarpa] Length = 440 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/38 (65%), Positives = 35/38 (92%) Frame = -2 Query: 116 ENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 E +++A+VPLLKL++LT+ GL+LAHPK Q+VP+ATFKL Sbjct: 6 EIVEAAIVPLLKLIALTLFGLILAHPKIQLVPKATFKL 43 >ref|XP_006300471.1| hypothetical protein CARUB_v10020273mg [Capsella rubella] gi|482569181|gb|EOA33369.1| hypothetical protein CARUB_v10020273mg [Capsella rubella] Length = 456 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/37 (70%), Positives = 34/37 (91%) Frame = -2 Query: 113 NLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 ++ S VVPL+KL+ LT+IGL+LAHPKTQ+VPRATF+L Sbjct: 15 DILSGVVPLMKLICLTLIGLLLAHPKTQLVPRATFRL 51 >gb|EMS47209.1| Protein DEHYDRATION-INDUCED 19-like protein 5 [Triticum urartu] Length = 675 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 104 SAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 SAV PLLKLL LTVIGL+LAHP+ Q+VP+ATFKL Sbjct: 14 SAVTPLLKLLCLTVIGLLLAHPRAQVVPKATFKL 47 >dbj|BAJ94383.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 453 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 104 SAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 SAV PLLKLL LTVIGL+LAHP+ Q+VP+ATFKL Sbjct: 14 SAVTPLLKLLCLTVIGLLLAHPRAQVVPKATFKL 47 >ref|XP_002305851.1| hypothetical protein POPTR_0004s09210g [Populus trichocarpa] gi|222848815|gb|EEE86362.1| hypothetical protein POPTR_0004s09210g [Populus trichocarpa] Length = 454 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = -2 Query: 161 ISKNIKERKMSGFLEENLQSAVVPLLKLLSLTVIGLVLAHPKTQIVPRATFKL 3 + KNIK E ++SA++PLLKL++L + GL+LAHPK Q+VP+ATFKL Sbjct: 9 VQKNIKSEG------EEVKSAILPLLKLIALALPGLILAHPKVQLVPKATFKL 55