BLASTX nr result
ID: Akebia23_contig00042349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00042349 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG21860.1| hypothetical protein MPH_00780 [Macrophomina phas... 69 7e-10 ref|XP_007579869.1| putative stf2-like protein [Neofusicoccum pa... 68 1e-09 ref|XP_002797758.1| conserved hypothetical protein [Paracoccidio... 57 2e-06 gb|EEH16504.1| hypothetical protein PABG_06591 [Paracoccidioides... 57 2e-06 gb|EON62872.1| hypothetical protein W97_02097 [Coniosporium apol... 57 3e-06 ref|XP_001795424.1| hypothetical protein SNOG_05013 [Phaeosphaer... 57 3e-06 gb|ELR04326.1| hypothetical protein GMDG_06708 [Pseudogymnoascus... 56 5e-06 gb|EGE85335.1| hypothetical protein BDDG_08280 [Ajellomyces derm... 56 6e-06 ref|XP_002620146.1| conserved hypothetical protein [Ajellomyces ... 56 6e-06 >gb|EKG21860.1| hypothetical protein MPH_00780 [Macrophomina phaseolina MS6] Length = 137 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = -2 Query: 297 KTKFETIEPEPVFEEDIHGPLAEDYGGADLEKESTASSAGSGSVLEEEDGLVEKK 133 KTKFETI+PEPVFEE++HGP AEDY ADLEK ST S+ + ++EED KK Sbjct: 84 KTKFETIDPEPVFEEELHGPRAEDY--ADLEKMSTGDSSNTEGSIQEEDSAHNKK 136 >ref|XP_007579869.1| putative stf2-like protein [Neofusicoccum parvum UCRNP2] gi|485929218|gb|EOD52670.1| putative stf2-like protein [Neofusicoccum parvum UCRNP2] Length = 137 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = -2 Query: 297 KTKFETIEPEPVFEEDIHGPLAEDYGGADLEKESTASSAGSGSVLEEEDGLVEKK 133 KTKFETI+PEPVFEE++HGP AEDY ADLEK ST S+ + ++EED KK Sbjct: 84 KTKFETIDPEPVFEEELHGPRAEDY--ADLEKMSTGESSHTEGSIQEEDSAHNKK 136 >ref|XP_002797758.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] gi|226280408|gb|EEH35974.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] Length = 139 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/59 (52%), Positives = 38/59 (64%) Frame = -2 Query: 330 SFSTAPGHIMTKTKFETIEPEPVFEEDIHGPLAEDYGGADLEKESTASSAGSGSVLEEE 154 S S+ G KTKFETIEP+PVFEE++HGP+ D G D +K+ST SS S E E Sbjct: 78 SNSSTQGLADFKTKFETIEPDPVFEEEVHGPVG-DMDGVDGDKKSTESSTSGVSEAESE 135 >gb|EEH16504.1| hypothetical protein PABG_06591 [Paracoccidioides brasiliensis Pb03] Length = 76 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/59 (52%), Positives = 38/59 (64%) Frame = -2 Query: 330 SFSTAPGHIMTKTKFETIEPEPVFEEDIHGPLAEDYGGADLEKESTASSAGSGSVLEEE 154 S S+ G KTKFETIEP+PVFEE++HGP+ D G D +K+ST SS S E E Sbjct: 15 SNSSTQGLADFKTKFETIEPDPVFEEEVHGPVG-DMDGVDGDKKSTESSTSGVSEAESE 72 >gb|EON62872.1| hypothetical protein W97_02097 [Coniosporium apollinis CBS 100218] Length = 172 Score = 57.0 bits (136), Expect = 3e-06 Identities = 35/67 (52%), Positives = 42/67 (62%), Gaps = 5/67 (7%) Frame = -2 Query: 333 NSFSTAPGHIMTKTKFETIEPEPVFEEDIHGPLAEDYGG-----ADLEKESTASSAGSGS 169 NS ST P + KTKFET+E EPVFEE++HGP+ GG A+LE T SS+ S Sbjct: 105 NSSSTGPSSAL-KTKFETVEAEPVFEEELHGPVTVPGGGSEDSAAELEHSITGSSSDL-S 162 Query: 168 VLEEEDG 148 V EEE G Sbjct: 163 VQEEESG 169 >ref|XP_001795424.1| hypothetical protein SNOG_05013 [Phaeosphaeria nodorum SN15] gi|160706493|gb|EAT87404.2| hypothetical protein SNOG_05013 [Phaeosphaeria nodorum SN15] Length = 64 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 2/60 (3%) Frame = -2 Query: 324 STAPGHIMT--KTKFETIEPEPVFEEDIHGPLAEDYGGADLEKESTASSAGSGSVLEEED 151 S + H+M KTKFET+E EPVFEE+IHGP+ G +LEK+STASS S ++EED Sbjct: 8 SNSSTHVMEDFKTKFETVEIEPVFEEEIHGPM-----GEELEKQSTASSDKS---IDEED 59 >gb|ELR04326.1| hypothetical protein GMDG_06708 [Pseudogymnoascus destructans 20631-21] Length = 159 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/60 (53%), Positives = 37/60 (61%) Frame = -2 Query: 333 NSFSTAPGHIMTKTKFETIEPEPVFEEDIHGPLAEDYGGADLEKESTASSAGSGSVLEEE 154 NS S A G KTKFE +P+PVFEE+IHG ED+ A +T SS G GSV EEE Sbjct: 95 NSSSYAAGLKDFKTKFELFDPDPVFEENIHGARPEDHMEAASRVTTTESSEGGGSVDEEE 154 >gb|EGE85335.1| hypothetical protein BDDG_08280 [Ajellomyces dermatitidis ATCC 18188] Length = 203 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/60 (51%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = -2 Query: 330 SFSTAPGHIMTKTKFETIEPEPVFEEDIHGPLAEDYGGAD-LEKESTASSAGSGSVLEEE 154 S S+ G KTKFET+EP+PVFEE+IHGPL ED G D + +S SS S E E Sbjct: 140 SNSSTQGLAEFKTKFETVEPDPVFEEEIHGPLHEDINGVDGIGVKSNESSTSGTSEAEIE 199 >ref|XP_002620146.1| conserved hypothetical protein [Ajellomyces dermatitidis SLH14081] gi|239594196|gb|EEQ76777.1| conserved hypothetical protein [Ajellomyces dermatitidis SLH14081] gi|239609249|gb|EEQ86236.1| conserved hypothetical protein [Ajellomyces dermatitidis ER-3] gi|531979441|gb|EQL30028.1| hypothetical protein BDFG_07425 [Ajellomyces dermatitidis ATCC 26199] Length = 137 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/60 (51%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = -2 Query: 330 SFSTAPGHIMTKTKFETIEPEPVFEEDIHGPLAEDYGGAD-LEKESTASSAGSGSVLEEE 154 S S+ G KTKFET+EP+PVFEE+IHGPL ED G D + +S SS S E E Sbjct: 74 SNSSTQGLAEFKTKFETVEPDPVFEEEIHGPLHEDINGVDGIGVKSNESSTSGTSEAEIE 133