BLASTX nr result
ID: Akebia23_contig00042202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00042202 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203470.1| hypothetical protein PRUPE_ppa024598mg [Prun... 145 4e-33 ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containi... 145 7e-33 ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containi... 144 1e-32 ref|XP_006371932.1| hypothetical protein POPTR_0018s06450g [Popu... 143 3e-32 emb|CBI28140.3| unnamed protein product [Vitis vinifera] 142 4e-32 ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containi... 142 4e-32 ref|XP_002324235.2| pentatricopeptide repeat-containing family p... 142 5e-32 gb|EXB86239.1| hypothetical protein L484_005950 [Morus notabilis] 142 6e-32 emb|CBI28813.3| unnamed protein product [Vitis vinifera] 141 8e-32 ref|XP_002269269.1| PREDICTED: pentatricopeptide repeat-containi... 141 8e-32 ref|XP_007013366.1| Pentatricopeptide repeat-containing protein,... 141 1e-31 gb|EXB96783.1| hypothetical protein L484_001891 [Morus notabilis] 140 1e-31 ref|XP_007225539.1| hypothetical protein PRUPE_ppa026705mg [Prun... 140 1e-31 ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containi... 140 2e-31 ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containi... 140 2e-31 ref|XP_006475804.1| PREDICTED: pentatricopeptide repeat-containi... 140 2e-31 ref|XP_006450982.1| hypothetical protein CICLE_v10010823mg [Citr... 140 2e-31 ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, part... 140 2e-31 ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containi... 140 2e-31 ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containi... 138 9e-31 >ref|XP_007203470.1| hypothetical protein PRUPE_ppa024598mg [Prunus persica] gi|462399001|gb|EMJ04669.1| hypothetical protein PRUPE_ppa024598mg [Prunus persica] Length = 722 Score = 145 bits (367), Expect = 4e-33 Identities = 67/77 (87%), Positives = 73/77 (94%) Frame = +1 Query: 1 EKENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDR 180 EKE +LS HSEKLAI+FGLISTNPGT IRVVKNLRVCSDCH+ATK+ISK+YNREIIVRDR Sbjct: 646 EKETALSLHSEKLAIAFGLISTNPGTTIRVVKNLRVCSDCHTATKIISKVYNREIIVRDR 705 Query: 181 NRFHHFKDGSCSCKDFW 231 NRFH F+DGSCSCKDFW Sbjct: 706 NRFHRFQDGSCSCKDFW 722 >ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] gi|449529868|ref|XP_004171920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Length = 734 Score = 145 bits (365), Expect = 7e-33 Identities = 64/76 (84%), Positives = 71/76 (93%) Frame = +1 Query: 4 KENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDRN 183 KE +LSHHSEKLAI+FGLIST PGTPIR++KNLRVC +CHSATKLISKI+NREII RDRN Sbjct: 659 KEGALSHHSEKLAIAFGLISTKPGTPIRIIKNLRVCRNCHSATKLISKIFNREIIARDRN 718 Query: 184 RFHHFKDGSCSCKDFW 231 RFHHFKDGSCSC D+W Sbjct: 719 RFHHFKDGSCSCNDYW 734 >ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 659 Score = 144 bits (363), Expect = 1e-32 Identities = 67/77 (87%), Positives = 72/77 (93%) Frame = +1 Query: 1 EKENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDR 180 +KE + S HSEKLAI+FGLISTNPGT IRVVKNLRVCSDCH+ATKLISK+YNREIIVRDR Sbjct: 583 DKETAHSLHSEKLAIAFGLISTNPGTTIRVVKNLRVCSDCHTATKLISKVYNREIIVRDR 642 Query: 181 NRFHHFKDGSCSCKDFW 231 NRFH FKDGSCSCKDFW Sbjct: 643 NRFHQFKDGSCSCKDFW 659 >ref|XP_006371932.1| hypothetical protein POPTR_0018s06450g [Populus trichocarpa] gi|550318175|gb|ERP49729.1| hypothetical protein POPTR_0018s06450g [Populus trichocarpa] Length = 717 Score = 143 bits (360), Expect = 3e-32 Identities = 65/77 (84%), Positives = 72/77 (93%) Frame = +1 Query: 1 EKENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDR 180 EKE LS HSEKLAI+FGL+ST+ GTPIRVVKNLR+CSDCHSATKLISK+YNREIIVRDR Sbjct: 641 EKETELSLHSEKLAIAFGLLSTSVGTPIRVVKNLRICSDCHSATKLISKLYNREIIVRDR 700 Query: 181 NRFHHFKDGSCSCKDFW 231 NRFHHFKDG+CSC+ FW Sbjct: 701 NRFHHFKDGTCSCRGFW 717 >emb|CBI28140.3| unnamed protein product [Vitis vinifera] Length = 580 Score = 142 bits (359), Expect = 4e-32 Identities = 65/77 (84%), Positives = 70/77 (90%) Frame = +1 Query: 1 EKENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDR 180 EKEN LS HSEKLAI+FGL+ST PGTPIRVVKNLRVCSDCHSA K IS++YNREIIVRDR Sbjct: 504 EKENELSLHSEKLAIAFGLLSTTPGTPIRVVKNLRVCSDCHSAMKFISEVYNREIIVRDR 563 Query: 181 NRFHHFKDGSCSCKDFW 231 NRFHHF GSCSC+DFW Sbjct: 564 NRFHHFTKGSCSCRDFW 580 >ref|XP_002281711.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Vitis vinifera] Length = 711 Score = 142 bits (359), Expect = 4e-32 Identities = 65/77 (84%), Positives = 70/77 (90%) Frame = +1 Query: 1 EKENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDR 180 EKEN LS HSEKLAI+FGL+ST PGTPIRVVKNLRVCSDCHSA K IS++YNREIIVRDR Sbjct: 635 EKENELSLHSEKLAIAFGLLSTTPGTPIRVVKNLRVCSDCHSAMKFISEVYNREIIVRDR 694 Query: 181 NRFHHFKDGSCSCKDFW 231 NRFHHF GSCSC+DFW Sbjct: 695 NRFHHFTKGSCSCRDFW 711 >ref|XP_002324235.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550317719|gb|EEF02800.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 736 Score = 142 bits (358), Expect = 5e-32 Identities = 64/76 (84%), Positives = 70/76 (92%) Frame = +1 Query: 4 KENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDRN 183 KE LSHHSEKLAI+FGLIST PGT IR++KNLRVC +CHSATKLISKI+NREII RDRN Sbjct: 661 KEGVLSHHSEKLAIAFGLISTKPGTTIRIMKNLRVCGNCHSATKLISKIFNREIIARDRN 720 Query: 184 RFHHFKDGSCSCKDFW 231 RFHHFKDGSCSCKD+W Sbjct: 721 RFHHFKDGSCSCKDYW 736 >gb|EXB86239.1| hypothetical protein L484_005950 [Morus notabilis] Length = 737 Score = 142 bits (357), Expect = 6e-32 Identities = 64/76 (84%), Positives = 70/76 (92%) Frame = +1 Query: 4 KENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDRN 183 KE SLSHHSEKLAI+FGLIST PGT IR+VKNLRVC +CHSATKLISKI+NREII RDRN Sbjct: 662 KEGSLSHHSEKLAIAFGLISTKPGTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRN 721 Query: 184 RFHHFKDGSCSCKDFW 231 RFHHFK+GSCSC D+W Sbjct: 722 RFHHFKNGSCSCNDYW 737 >emb|CBI28813.3| unnamed protein product [Vitis vinifera] Length = 500 Score = 141 bits (356), Expect = 8e-32 Identities = 64/77 (83%), Positives = 70/77 (90%) Frame = +1 Query: 1 EKENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDR 180 EKE +L HHSEKLAI+FGLI T+PGT IR+ KNLRVC+DCHSATKLISKIYNREIIVRDR Sbjct: 424 EKETALCHHSEKLAIAFGLIKTDPGTTIRITKNLRVCADCHSATKLISKIYNREIIVRDR 483 Query: 181 NRFHHFKDGSCSCKDFW 231 RFHHF+DGSCSC DFW Sbjct: 484 CRFHHFRDGSCSCMDFW 500 >ref|XP_002269269.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 640 Score = 141 bits (356), Expect = 8e-32 Identities = 64/77 (83%), Positives = 70/77 (90%) Frame = +1 Query: 1 EKENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDR 180 EKE +L HHSEKLAI+FGLI T+PGT IR+ KNLRVC+DCHSATKLISKIYNREIIVRDR Sbjct: 564 EKETALCHHSEKLAIAFGLIKTDPGTTIRITKNLRVCADCHSATKLISKIYNREIIVRDR 623 Query: 181 NRFHHFKDGSCSCKDFW 231 RFHHF+DGSCSC DFW Sbjct: 624 CRFHHFRDGSCSCMDFW 640 >ref|XP_007013366.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508783729|gb|EOY30985.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 194 Score = 141 bits (355), Expect = 1e-31 Identities = 63/76 (82%), Positives = 70/76 (92%) Frame = +1 Query: 4 KENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDRN 183 KE +LSHHSEKLAI+FGLIST PGT IR+VKNLRVC +CHSATKLISKI+N+EII RDRN Sbjct: 119 KEEALSHHSEKLAIAFGLISTKPGTTIRIVKNLRVCGNCHSATKLISKIFNKEIIARDRN 178 Query: 184 RFHHFKDGSCSCKDFW 231 RFHHFKDG CSCKD+W Sbjct: 179 RFHHFKDGFCSCKDYW 194 >gb|EXB96783.1| hypothetical protein L484_001891 [Morus notabilis] Length = 599 Score = 140 bits (354), Expect = 1e-31 Identities = 62/77 (80%), Positives = 71/77 (92%) Frame = +1 Query: 1 EKENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDR 180 +KE++L+ HSEKLAI+F L++T PGTPIR+VKNLRVCSDCHSATK ISKIYNREI+VRDR Sbjct: 523 DKEDALNRHSEKLAIAFALLNTPPGTPIRIVKNLRVCSDCHSATKFISKIYNREIVVRDR 582 Query: 181 NRFHHFKDGSCSCKDFW 231 NRFHHF DG CSCKDFW Sbjct: 583 NRFHHFMDGLCSCKDFW 599 >ref|XP_007225539.1| hypothetical protein PRUPE_ppa026705mg [Prunus persica] gi|462422475|gb|EMJ26738.1| hypothetical protein PRUPE_ppa026705mg [Prunus persica] Length = 484 Score = 140 bits (354), Expect = 1e-31 Identities = 61/77 (79%), Positives = 71/77 (92%) Frame = +1 Query: 1 EKENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDR 180 +KE++L+ HSEKLAI+F L++T PGTPIR+VKNLRVC DCHSATK ISKIYNREI+VRDR Sbjct: 408 DKEDALNRHSEKLAIAFALLNTPPGTPIRIVKNLRVCDDCHSATKFISKIYNREIVVRDR 467 Query: 181 NRFHHFKDGSCSCKDFW 231 NRFHHFKDG CSC+DFW Sbjct: 468 NRFHHFKDGMCSCRDFW 484 >ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X2 [Citrus sinensis] Length = 566 Score = 140 bits (353), Expect = 2e-31 Identities = 61/77 (79%), Positives = 72/77 (93%) Frame = +1 Query: 1 EKENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDR 180 +KE++L+ HSEKLAI+F L+ T PGTPIR+VKNLRVC+DCHSATK ISKIYNREI+VRDR Sbjct: 490 DKEDALNKHSEKLAIAFALLKTPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDR 549 Query: 181 NRFHHFKDGSCSCKDFW 231 +RFHHFKDGSCSC+DFW Sbjct: 550 HRFHHFKDGSCSCRDFW 566 >ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X1 [Citrus sinensis] Length = 600 Score = 140 bits (353), Expect = 2e-31 Identities = 61/77 (79%), Positives = 72/77 (93%) Frame = +1 Query: 1 EKENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDR 180 +KE++L+ HSEKLAI+F L+ T PGTPIR+VKNLRVC+DCHSATK ISKIYNREI+VRDR Sbjct: 524 DKEDALNKHSEKLAIAFALLKTPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDR 583 Query: 181 NRFHHFKDGSCSCKDFW 231 +RFHHFKDGSCSC+DFW Sbjct: 584 HRFHHFKDGSCSCRDFW 600 >ref|XP_006475804.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Citrus sinensis] Length = 736 Score = 140 bits (353), Expect = 2e-31 Identities = 62/76 (81%), Positives = 70/76 (92%) Frame = +1 Query: 4 KENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDRN 183 KE +LSHHSEKLAI++GLIST PGT IR+VKNLRVC +CHSATKLISKI+NREII RDRN Sbjct: 661 KEGALSHHSEKLAIAYGLISTKPGTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRN 720 Query: 184 RFHHFKDGSCSCKDFW 231 RFHHFKDG+CSC D+W Sbjct: 721 RFHHFKDGNCSCNDYW 736 >ref|XP_006450982.1| hypothetical protein CICLE_v10010823mg [Citrus clementina] gi|557554208|gb|ESR64222.1| hypothetical protein CICLE_v10010823mg [Citrus clementina] Length = 736 Score = 140 bits (353), Expect = 2e-31 Identities = 62/76 (81%), Positives = 70/76 (92%) Frame = +1 Query: 4 KENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDRN 183 KE +LSHHSEKLAI++GLIST PGT IR+VKNLRVC +CHSATKLISKI+NREII RDRN Sbjct: 661 KEGALSHHSEKLAIAYGLISTKPGTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRN 720 Query: 184 RFHHFKDGSCSCKDFW 231 RFHHFKDG+CSC D+W Sbjct: 721 RFHHFKDGNCSCNDYW 736 >ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] gi|557553684|gb|ESR63698.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] Length = 629 Score = 140 bits (353), Expect = 2e-31 Identities = 61/77 (79%), Positives = 72/77 (93%) Frame = +1 Query: 1 EKENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDR 180 +KE++L+ HSEKLAI+F L+ T PGTPIR+VKNLRVC+DCHSATK ISKIYNREI+VRDR Sbjct: 553 DKEDALNKHSEKLAIAFALLKTPPGTPIRIVKNLRVCNDCHSATKFISKIYNREIVVRDR 612 Query: 181 NRFHHFKDGSCSCKDFW 231 +RFHHFKDGSCSC+DFW Sbjct: 613 HRFHHFKDGSCSCRDFW 629 >ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Setaria italica] Length = 695 Score = 140 bits (352), Expect = 2e-31 Identities = 62/77 (80%), Positives = 70/77 (90%) Frame = +1 Query: 1 EKENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDR 180 EKE S+SHHSEKLAI+FGL+ PGT IR+ KNLRVC+DCHSATKLISK+YNREI+VRDR Sbjct: 619 EKEVSVSHHSEKLAIAFGLMKLRPGTTIRLSKNLRVCTDCHSATKLISKVYNREIVVRDR 678 Query: 181 NRFHHFKDGSCSCKDFW 231 NRFHHFKDGSCSC D+W Sbjct: 679 NRFHHFKDGSCSCNDYW 695 >ref|XP_002274432.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 738 Score = 138 bits (347), Expect = 9e-31 Identities = 63/76 (82%), Positives = 68/76 (89%) Frame = +1 Query: 4 KENSLSHHSEKLAISFGLISTNPGTPIRVVKNLRVCSDCHSATKLISKIYNREIIVRDRN 183 KE SLSHHSEKLAI+FGLIST P T IR+VKNLRVC +CHSA KLISKI+NREII RDRN Sbjct: 663 KEGSLSHHSEKLAIAFGLISTKPETTIRIVKNLRVCGNCHSAIKLISKIFNREIIARDRN 722 Query: 184 RFHHFKDGSCSCKDFW 231 RFHHFKDGSCSC D+W Sbjct: 723 RFHHFKDGSCSCMDYW 738