BLASTX nr result
ID: Akebia23_contig00040842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00040842 (214 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF89648.1|AF168599_1 P0 protein [Beet mild yellowing virus] 56 5e-06 >gb|AAF89648.1|AF168599_1 P0 protein [Beet mild yellowing virus] Length = 239 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/67 (40%), Positives = 38/67 (56%) Frame = +2 Query: 14 SVDIRRPQADNVARSLLQRSWSSNFGERLSRHHEPFTYGERHFLALLHVWGGQSSENRKS 193 ++D+R P +V R L R+ N GERL RH E F++GE F L VW +S + Sbjct: 94 NIDLRVPPRKDVKRFYLARNSGRNLGERLQRHREIFSHGEAEFKKFLSVWCAESERKLRE 153 Query: 194 YPRIHIK 214 P+I+IK Sbjct: 154 SPKINIK 160