BLASTX nr result
ID: Akebia23_contig00040716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00040716 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC32925.1| Putative arsenical pump-driving ATPase [Morus not... 57 3e-06 >gb|EXC32925.1| Putative arsenical pump-driving ATPase [Morus notabilis] Length = 410 Score = 56.6 bits (135), Expect = 3e-06 Identities = 33/65 (50%), Positives = 41/65 (63%), Gaps = 1/65 (1%) Frame = -1 Query: 192 PF-HRFSASNSMAMAGFLVHFSKNQTHFSLLRITRDFTSIHLPTTRKPYRNLFQVRSVAA 16 PF H+F+ NSMAM G L + K+ T SL ++ FT I T RKP + FQVRSVAA Sbjct: 12 PFIHKFTGRNSMAMMGLLSYARKSPTPISLT--SKSFTFISRSTARKPLKKSFQVRSVAA 69 Query: 15 PADAV 1 P +AV Sbjct: 70 PTEAV 74