BLASTX nr result
ID: Akebia23_contig00040692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00040692 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533989.1| ring finger protein, putative [Ricinus commu... 58 1e-06 ref|XP_006845494.1| hypothetical protein AMTR_s00019p00149380 [A... 57 3e-06 >ref|XP_002533989.1| ring finger protein, putative [Ricinus communis] gi|223526024|gb|EEF28396.1| ring finger protein, putative [Ricinus communis] Length = 495 Score = 58.2 bits (139), Expect = 1e-06 Identities = 39/104 (37%), Positives = 52/104 (50%), Gaps = 13/104 (12%) Frame = +2 Query: 2 STCPLCRGSLLPDFPTNSCRXXXXXXXXXXXXXXXXIVLDRD----PSSI--SGTQIGFH 163 STCPLCRGSLLP+F +NS I+ DRD SS+ + + +GFH Sbjct: 170 STCPLCRGSLLPEFSSNSSCSPVVLVLESGSESSREIITDRDNIGRTSSVLTTNSYLGFH 229 Query: 164 GEDQFGSPCNDVSMKISEIPFMGSPISEE-------KVVQVKLG 274 G+++ GS ++S+K EI S KVV VKLG Sbjct: 230 GDNELGSSRIEISLKSGEILGKNESFSPRVAVDSGAKVVPVKLG 273 >ref|XP_006845494.1| hypothetical protein AMTR_s00019p00149380 [Amborella trichopoda] gi|548848066|gb|ERN07169.1| hypothetical protein AMTR_s00019p00149380 [Amborella trichopoda] Length = 494 Score = 56.6 bits (135), Expect = 3e-06 Identities = 40/98 (40%), Positives = 48/98 (48%), Gaps = 7/98 (7%) Frame = +2 Query: 2 STCPLCRGSLLPDFPTNSCRXXXXXXXXXXXXXXXXIVLDRDPS--SISGTQIGFHGEDQ 175 STCPLCRGSLLPDF +C + L+R I+ +Q+G GED Sbjct: 150 STCPLCRGSLLPDFSAPNCSPVVLVLESGSESSREMVNLERGVGQVGINASQVGLSGEDG 209 Query: 176 FGSPCNDVSMKISEI--PFMGS---PISEEKVVQVKLG 274 FGS + S K EI F+ SE KVV VKLG Sbjct: 210 FGSSRTENSRKPGEIGDGFLEREEVKSSEMKVVPVKLG 247