BLASTX nr result
ID: Akebia23_contig00040525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00040525 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007218962.1| hypothetical protein PRUPE_ppa003628mg [Prun... 64 3e-08 ref|XP_002275846.1| PREDICTED: transcription factor GAMYB [Vitis... 62 8e-08 ref|XP_004306467.1| PREDICTED: transcription factor GAMYB-like [... 61 2e-07 >ref|XP_007218962.1| hypothetical protein PRUPE_ppa003628mg [Prunus persica] gi|462415424|gb|EMJ20161.1| hypothetical protein PRUPE_ppa003628mg [Prunus persica] Length = 560 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -3 Query: 140 MSRTTNESEDEMLLKDQVDSPSIDEGIYDGSLGGGGAILKKGPWTS 3 MSRTTNESED +L KDQ++SP +DE +G G GG +LKKGPWTS Sbjct: 1 MSRTTNESEDGVLSKDQIESPLMDES--NGGTGNGGIVLKKGPWTS 44 >ref|XP_002275846.1| PREDICTED: transcription factor GAMYB [Vitis vinifera] gi|298205121|emb|CBI40642.3| unnamed protein product [Vitis vinifera] Length = 559 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/46 (69%), Positives = 33/46 (71%) Frame = -3 Query: 140 MSRTTNESEDEMLLKDQVDSPSIDEGIYDGSLGGGGAILKKGPWTS 3 MS TNESED ML KDQ SP IDEG GS GGG +LKKGPWTS Sbjct: 1 MSHLTNESEDGMLSKDQTGSPLIDEGNSSGS-AGGGIVLKKGPWTS 45 >ref|XP_004306467.1| PREDICTED: transcription factor GAMYB-like [Fragaria vesca subsp. vesca] Length = 562 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -3 Query: 140 MSRTTNESEDEMLLKDQVDSPSIDEGIYDGSLGGGGAILKKGPWTS 3 MSRTT++SED M KDQ++SP +DE +G +G GG ILKKGPWT+ Sbjct: 1 MSRTTSDSEDGMFSKDQIESPLMDEN--NGGIGNGGIILKKGPWTT 44